KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1341Help
Entry
NMBM01240149_1341 CDS       T01930                                 

Gene name
folK
Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    NMBM01240149_1341 (folK)
Enzymes [BR:nmm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     NMBM01240149_1341 (folK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1478874..1479368
Genome map
AA seq 164 aa AA seqDB search
MNNRHFAVIALGSNLENPAQQVRAALDTLSSHPDIRLKQASSLYMTAPVGYDNQPDFVNA
VCTVSTTLDGIALLAELNRIEADFGRERSFRNAPRTLDLDIIDFDGISSDDTRLTLPHPR
AHERSFVIRPLAEILPDFVLGKHGKVAELSKRLGNQGIRLLPDR
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgaacaacagacattttgccgtcatcgccctgggcagtaatcttgaaaaccctgcccaa
caggtacgcgccgcattggacacgctgtcgtcccatcctgacatccgtcttaaacaggct
tcctcactgtatatgaccgcgcccgtcggttacgacaatcagcccgattttgtcaatgcc
gtctgcaccgtttccaccactctggacggcattgccctgcttgccgaactcaaccgtatc
gaggctgatttcggacgcgaacgcagcttccgcaacgcgccgcgcacattggatttggac
attatcgactttgacggcatctccagcgacgacacccgactcaccctgccgcatccgcgc
gcgcacgaacgcagtttcgtcatccgccctttggcagaaatcctccctgattttgtttta
ggaaaacacggaaaggttgccgaattgtcaaaacggctgggcaatcaaggtatccgtctt
ttacccgacaggtaa

DBGET integrated database retrieval system