KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1393Help
Entry
NMBM01240149_1393 CDS       T01930                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMBM01240149_1393 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMBM01240149_1393 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMBM01240149_1393 (trpB)
Enzymes [BR:nmm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMBM01240149_1393 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
Position
complement(1533596..1534798)
Genome map
AA seq 400 aa AA seqDB search
MKNYHAPDEKGVFGEHGGLYVSETLIPALQELADAYKAAKNDPSFWEEFHRDLKHYVGRP
SPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQH
GVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVDSGSRTLKDAMNEAMR
EWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKEQMLEAIGRQPDVAVACVGGGS
NAIGLFHPYIGEENVRLVGVEAGGLGVNTPDHAAPITSGSPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALEAFDLLCRFEGIIPALESSHA
VAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattaccacgcacccgacgagaagggcgttttcggcgaacacggtgggctttat
gtttccgagaccctgattcccgccttgcaagagctggcggatgcctataaggcagcgaaa
aacgacccgtcgttttgggaagaattccaccgcgatttgaaacactacgtcggcaggccc
agccccgtttaccatgccgcgcgattgtccgagcatttgggtggcgcgcaaatttggttg
aagcgcgaagacttgaaccacaccggcgcgcacaaagtcaacaacaccatcggtcaggca
ctgttggcaaaacgtatgggtaaaaaacgcgtcatcgccgaaaccggcgcgggtcagcac
ggcgtggcgagtgccactgttgccgcccgcttcggcatgacttgcgacgtgtacatgggt
gcggacgacatccaacgccaaatgcccaacgtgttccgtatgaaattattgggcgcgaat
gtcgtcggcgttgacagcggcagccgtactttgaaagacgcgatgaacgaagccatgcgc
gaatgggtcgcccgcgtggatgacacattctacatcatcggtaccgccgccggtcccgcg
ccgtatcccgaaatggtgcgcgactttcaatgcgtgatcggcaatgaagccaaagaacaa
atgttggaagccatcggcagacagcccgacgttgccgttgcctgcgtgggcggcggatcg
aacgccattggtttgttccacccgtatatcggcgaagaaaacgtgcgcctcgtcggcgtg
gaggctggcggtttgggcgtgaacacccccgatcacgccgcgccgattacttcgggctca
ccgattggcgtattgcacggtttccgcagctatctgatgcaggacgaaaacggtcaagtc
ttgggtacacactctgtttccgcaggcttggattaccccggcatcggcccggaacacagc
catctgcacgacatcaagcgcgtcgaatacaccgttgccaaagacgacgaagcactcgaa
gcctttgacttgctctgccgcttcgagggcatcatccccgcgctcgaatccagccacgcc
gttgcttgggcggtgaaaaatgcgccgaaaatgggtaaagaccaagtgattctggtcaac
ctctcaggtcgtggcgacaaagacatcaataccgtcgcgaagctcaaagggattaaactg
taa

DBGET integrated database retrieval system