KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1557Help
Entry
NMBM01240149_1557 CDS       T01930                                 

Definition
oxidoreductase, zinc-binding dehydrogenase family (EC:1.-.-.-)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NMBM01240149_1557
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM01240149_1557
  Lipid metabolism
   00071 Fatty acid degradation
    NMBM01240149_1557
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMBM01240149_1557
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMBM01240149_1557
   00626 Naphthalene degradation
    NMBM01240149_1557
Enzymes [BR:nmm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMBM01240149_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1697487..1698527
Genome map
AA seq 346 aa AA seqDB search
MQAVVVNKNVAGDVEIVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVLGH
EGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGGMA
THCIVNADYAVKVPDGLDPAQASSITCAGVTTYKAIKVSSVRPGQWIAIYGAGGLGNLGV
QYAKKVFGAHVVAIDINDDKLAFAKESGADLVVNAAKEDAAKVIQEKTGGAHAAVVTAVS
AAAFNSAVNCVRAGGRVVAIGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQFGA
EGLVVPKVQLRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1041 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaaatagtcgaacgcgag
gttcgcccgttggaatacggcgaggcgttggtcgaagtcgaatattgcggcgtgtgccac
accgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgctgggacac
gagggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtcggcgac
cgcgtcagcatcgcctggctgttccaaagctgcggctcttgcgaatactgcaataccggc
cgcgaaaccctgtgccgctctgtattgaacgcgggctacaccgccgacggcggtatggcg
acccactgcatcgtcaatgcggattatgcggtcaaagtccccgacggtctcgaccccgcc
caagcgtccagcatcacttgtgccggcgtgaccacttataaagccattaaagtttccagt
gttcgtccgggacagtggattgccatctacggcgcgggcggtttgggcaacttgggggtc
caatacgcgaaaaaagtattcggcgcgcacgttgtcgccatcgacatcaacgacgacaaa
ctggcgtttgccaaagaaagcggcgcggatttggttgtcaacgccgccaaagaagacgct
gccaaagtgattcaggaaaaaacaggcggcgcacacgctgcggtcgtaaccgccgtatct
gctgccgcattcaactctgccgtgaattgcgtccgcgcgggcggacgtgtggttgccatc
ggactgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggcatcgaa
gtggtcggctctttggtcggcacgcgcaaagatttggaagaagccttccaattcggcgcg
gaaggtttggttgtgccgaaagtccaactgcgtgctttggatgaagcacccgccattttc
caagaaatgcgcgaaggcaaaatcaccggtcgtatggtaatcgatatgaaaaaagaatgc
ggctgcggccaccaccactga

DBGET integrated database retrieval system