KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1573Help
Entry
NMBM01240149_1573 CDS       T01930                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMBM01240149_1573
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NMBM01240149_1573
Enzymes [BR:nmm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NMBM01240149_1573
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1718378..1719463
Genome map
AA seq 361 aa AA seqDB search
MTVPHIPRGPVMADIAAFRLTGEERQRLLDPAIGGIILFRRNFQNIEQLKTLTAEIKALR
TPELIIAVDHEGGRVQRFIESFTRLPAMSTLGEIWDKDGASAAETAAGQVGRVLATELSA
CGIDLSFTPVLDLDWGNCPVIGNRSFHHNPEAVAHLALALQKGLAKGGMKSCGKHFPGHG
FVEGDSHLVLPEDRRSLSELEAADLAPFHIMSREGMAAVMPAHVVYPQVDTKPAGFSEIW
LKQILRRDIGFKGVIFSDDLTMEGACGAGGIKERARISFEAGCDIVLVCNRPDLVDELRE
DFRIPDNPALAQRWQYMANTLGSAAAQAVMQTADFQEAQAFVAGLASPQDTAGGVKVGEA
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgaccgtcccccatattccgcgcggccccgtcatggcagacattgccgccttccgcctg
accggagaagaaaggcaacgcctgctcgaccccgcaatcggcggcatcatcctcttccgc
cgcaacttccaaaacatcgaacaactcaaaacactcaccgccgaaatcaaagccctgcgc
acacccgaactcattatcgccgtcgatcacgaaggcggcagggtgcaacgtttcatcgaa
agcttcacccgcctgcccgcaatgagtacgctcggcgagatttgggacaaagacggcgcg
tccgccgccgaaaccgccgccggacaagtcggccgggttttggcaaccgagctttccgcc
tgcggcatcgatttgtccttcacgcccgtcttagatttggactggggaaactgccccgtc
atcggcaaccgcagtttccaccacaatcccgaagcggtcgcccacctcgccctcgccctt
caaaaaggtttggcaaaaggcggtatgaaatcctgcggcaaacattttcccggacacgga
tttgtcgaaggagacagccatctggtcttgccggaagacaggcgcagcctgtccgaactc
gaagccgccgacctcgcccccttccacattatgagccgcgaaggtatggcggcggttatg
cccgcccacgtcgtttatccacaagtggacacaaagcccgcagggttttccgaaatctgg
ctcaaacaaattttgcgccgcgacatcgggtttaaaggcgtaattttctcggatgatttg
actatggagggcgcgtgcggggcaggcggcatcaaagaacgcgcccgcatttcctttgag
gcaggttgcgacatcgtcctcgtctgcaaccgtcccgaccttgtggacgaactgcgcgaa
gatttccgcattcctgacaatcccgctttggcgcaacgttggcaatacatggccaacacg
ctcggcagtgccgccgcgcaagccgttatgcagacggcggatttccaagaggcgcaagcc
tttgttgccggccttgcctcgccgcaagacacggcgggcggcgtaaaagtcggcgaagcc
ttttaa

DBGET integrated database retrieval system