KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_1626Help
Entry
NMBM01240149_1626 CDS       T01930                                 

Definition
phospholipase A1 (EC:3.1.1.-)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:nmm00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:nmm00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:nmm00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:nmm00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1784030..1785157)
Genome map
AA seq 375 aa AA seqDB search
MNTRNMRYILLTGLLPMASAFGETALQCAALTDNVTRLACYDRIFAAQLPSSAGQEGQES
KAVLNLTETVRSSLDKGEAVIVVEKGGDALPADSAGETADIYTPLSLMYDLDKNDLRGLL
GVREHNPMYLMPLWYNNSPNYAPGSPTRGTTVQEKFGQQKRAETKLQVSFKSKIAEDLFK
TRADLWFGYTQRSDWQIYNQGRKSAPFRNTDYKPEIFLTQPVKADLPFGGRLRMLGAGFV
HQSNGQSRPESRSWNRIYAMAGMEWGKLTVIPRVWVRAFDQSGDKNDNPDIADYMGYGDV
KLQYRLNDRQNVYSVLRYNPKTGYGAIEAAYTFPIKGKLKGVVRGFHGYGESLIDYNHKQ
NGIGIGLMFNDLDGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacggaatatgcgctatattcttttgacaggactgttgccgatggcatccgct
tttggagagaccgcgctgcaatgcgccgctttgacggacaatgttacgcgtttggcgtgt
tacgacaggatttttgcggcacagcttccgtcttcggcagggcaggaagggcaggagtcg
aaagccgtactcaatctgacggaaaccgtccgcagcagcctggataagggcgaggcggtc
attgttgttgaaaaaggcggggatgcgcttcctgccgacagtgcgggcgaaaccgccgac
atctatacgcctttgagcctgatgtacgacttggacaaaaacgatttgcgcgggctgttg
ggcgtacgcgaacacaatccgatgtaccttatgccgctctggtacaacaattcgcccaac
tatgccccgggttcgccgacgcgcggtacgactgtacaggaaaaattcggacagcagaaa
cgtgcggaaaccaaattgcaggtttcgttcaaaagcaaaattgccgaagatttgtttaaa
acccgcgcggatctgtggttcggctacacccaaagatccgattggcagatttacaaccaa
ggcaggaaatccgcgccgttccgcaatacggattacaaacctgaaattttcctgacccag
cctgtgaaggcggatttgccgttcggcggcaggctgcgtatgctcggtgcgggttttgtc
caccagtccaacggacagagccgtcccgaatcgcgttcgtggaacaggatttacgccatg
gcaggcatggaatggggcaaattgacggtgattccgcgcgtgtgggtgcgtgcgttcgat
cagagcggcgataaaaacgacaatcccgatattgccgactatatggggtatggcgacgtg
aagctgcagtaccgcctgaacgacaggcagaatgtgtattccgtattgcgctacaacccc
aaaacgggctacggcgcgattgaagccgcctacacgtttccgattaagggcaaactcaaa
ggcgtggtacgcggattccacggttacggcgagagcctgatcgactacaaccacaagcag
aacggtatcggtatcgggttgatgttcaacgacttggacggcatctga

DBGET integrated database retrieval system