KEGG   Neisseria meningitidis M01-240149 (serogroup B): NMBM01240149_2055Help
Entry
NMBM01240149_2055 CDS       T01930                                 

Definition
isochorismatase family protein (EC:3.-.-.-)
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
nmm  Neisseria meningitidis M01-240149 (serogroup B)
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    NMBM01240149_2055
Enzymes [BR:nmm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     NMBM01240149_2055
    3.5.1.-  
     NMBM01240149_2055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2217674..2218309)
Genome map
AA seq 211 aa AA seqDB search
MIVSIDVDAQKTFTPLCPKELPVNEGHLIVEELNAQAALADLRVMTKDAHHAAAKWLVDN
PVDMLKPTGLPDADLTWVAHAMVGTRGYELLDGLPCAKEYDYCVWKGIDPELHPYGACFH
DIEEKLSTGLIEWLRCQNTDTVIIGGLATDYCVKTTVLQLLKGGRWQVVVNEAACRGIAP
ETIETAWQEMHSAGAIILKNADEINKYINNQ
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atgattgtttccattgatgttgatgcacaaaaaacttttacgcctttgtgtcctaaagag
ctgcctgtaaacgaggggcatttgattgtcgaagaattgaatgcccaagccgctttggcg
gatttgcgcgtgatgacgaaagatgcgcatcatgcggcagcaaaatggcttgtggataac
cctgttgatatgttgaagccgacaggtttgcccgatgcggatttgacttgggtggctcat
gcgatggttggtacgcgcggctatgaattgttggacgggctgccttgtgccaaagaatac
gattattgcgtttggaaaggtattgatcctgaattgcatccttacggcgcgtgttttcac
gatattgaggaaaaactaagcacagggctgattgaatggctgcgttgtcaaaatacggat
acggttattatcggtgggttagctacggattattgtgttaaaacaacggttttgcagtta
ctcaaaggcggtcgttggcaggttgtcgtcaatgaagcggcttgtcggggtattgcgccg
gaaaccatcgaaacagcatggcaggaaatgcattctgccggggcaatcatcttaaaaaac
gctgatgaaataaataaatatattaataatcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system