KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0089Help
Entry
NMCC_0089         CDS       T00633                                 

Gene name
rfbC2
Definition
dTDP-D-glucose 4,6-dehydratase
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    NMCC_0089 (rfbC2)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMCC_0089 (rfbC2)
Enzymes [BR:nmn01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     NMCC_0089 (rfbC2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87462..88001
Genome map
AA seq 179 aa AA seqDB search
MNIIDTAIPDVKLLEPQVFGDARGFFMETFRDEWFKTQVCERTFVQENHSKSGKGVLRGL
HYQTENTQGKLVRVVVGEVFDVAVDMREGSPTFGKWAGATLSAQNQCQLWIPEGFAHGFC
VLGDAAEVVYKCTDYYKPEAEQVLIWNDPTVGIGWPLQGEPNLSPKDLAGKVLAEAVTF
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcattgataccgccattcctgacgtaaaactgcttgagccccaagtcttcggc
gacgcgcgcggcttttttatggaaaccttccgcgacgagtggtttaaaacccaagtctgc
gaacgcaccttcgtgcaggaaaaccactccaaatccggcaaaggcgtattgcgcggcctg
cactatcaaaccgaaaacacacaaggcaaactcgtacgcgtggttgtcggcgaagtattc
gacgtggccgtcgatatgcgcgaaggttcgccgactttcggcaaatgggcgggcgcaacc
ctgtccgcgcaaaaccaatgccagctttggatacccgaaggcttcgcgcacgggttttgc
gttttgggcgacgcggcggaagtcgtgtacaaatgcaccgactattacaagcctgaagcc
gaacaggttttaatatggaacgacccgacagtcggcataggctggccgttgcaaggcgag
ccgaacctgtcgcctaaagacttggccggcaaagtattggctgaagcggtcacgttttaa

DBGET integrated database retrieval system