KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0334Help
Entry
NMCC_0334         CDS       T00633                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMCC_0334 (tpiA)
   01230 Biosynthesis of amino acids
    NMCC_0334 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMCC_0334 (tpiA)
   00051 Fructose and mannose metabolism
    NMCC_0334 (tpiA)
   00562 Inositol phosphate metabolism
    NMCC_0334 (tpiA)
Enzymes [BR:nmn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     NMCC_0334 (tpiA)
Exosome [BR:nmn04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   NMCC_0334 (tpiA)
  Exosomal proteins of bladder cancer cells
   NMCC_0334 (tpiA)
  Exosomal proteins of melanoma cells
   NMCC_0334 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(335803..336576)
Genome map
AA seq 257 aa AA seqDB search
MYHQIGMWDQKWVIGNWKMNGRLQNNNSLMHRFRILPTAERVLIGLAAPTVYLLQLHNAM
QIVLNNRILTCAQDVSRFPDNGAYTGEVSAEMLADTGTDIVLIGHSERSLYFGEKNEIQR
RKMENVLNVGLIPLLCVGESLEEREAGKEHEVIAHQLSILQGLDTKNIAVAYEPVWAIGT
GKVATVEQIADMHAFIYKEILSLCGSDVKIRVLYGGSVKADNAADIFAVPYVDGALVGGA
SLSYDSFTAIISAAQNA
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgtatcaccaaatcggaatgtgggatcaaaaatgggtcatcggcaactggaaaatgaac
ggccggctccaaaacaacaattcgctcatgcaccgcttccgcatcctccccaccgccgaa
cgcgtcctcatcggactcgccgccccgaccgtttacctgctgcaactgcacaacgccatg
caaatcgtcttaaacaaccgcatcctcacctgcgcccaagacgtgagccgcttccccgac
aacggcgcgtacaccggcgaagtgtccgccgaaatgctcgccgacaccggcacagacatc
gtcctcatcggacactccgaacgcagcctttatttcggcgaaaaaaacgaaatccaacgc
cgcaaaatggaaaacgtcctcaacgtcggactcatcccgttattgtgcgtcggcgaaagc
ctcgaagagcgcgaagccggcaaagaacacgaagtcatcgcccatcagctttccatcctg
caagggctggataccaaaaacatcgccgtcgcctacgaacccgtctgggcgatcggcacc
ggcaaagtcgccaccgtcgaacagattgccgatatgcacgcattcatctacaaagaaatc
ttgtctttgtgcggaagcgatgttaaaatccgtgtcctttacggcggaagtgtgaaagcg
gacaacgcggccgacatcttcgcagtaccttatgtggacggcgcactcgtcggcggcgcg
tcattgtcgtacgactcctttaccgccatcatcagtgccgcacaaaatgcgtag

DBGET integrated database retrieval system