KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0468Help
Entry
NMCC_0468         CDS       T00633                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:nmn00520]
Human Diseases; Drug resistance; beta-Lactam resistance [PATH:nmn00312]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(486631..487716)
Genome map
AA seq 361 aa AA seqDB search
MTVPCIPRGLVMADIAAFRLTEEEKQRLLDPAVGGVILFRRNFQNIAQLKELTAEIKALR
TPELIIAVDHEGGRVQRFIEGFTRLPAMSTLGEIWDKDGASAAETAAGQVGRVLATELSA
CGIDLSFTPVLDLDWGNCPVIGNRSFHRNPEAVARLALALQKGLEKGGMKSCGKHFPGHG
FVEGDSHLVLPEDGRSLSELEAADLAPFRIMSREGMAAVMPAHVVYPQVDTKPAGFSEIW
LKQILRRDIGFKGVIFSDDLTMEGACGAGGIKERARISFEAGCDIVLVCNRPDLVDELRE
DFRIPDNPALAQRWQYMANTLGSAAAQAVMQTTDFQAAQAFVAGLASPQDTAGGVKVGEA
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactgttccctgtattccgcgcggcctcgtcatggccgacattgccgccttccgcctg
accgaagaggaaaagcaacgccttctcgatcccgccgtcggcggagtcatcctgttccgc
cgcaacttccaaaatatcgcacagctcaaagaactcaccgccgaaatcaaagccctgcgc
acacccgaactcattatcgccgtcgatcacgaaggcggcagggtgcaacgtttcatcgaa
ggcttcacccgcctgcccgcaatgagtacgctcggcgagatttgggacaaagacggcgcg
tccgccgccgaaaccgccgccggacaagtcggccgggttttggcaaccgagctttccgcc
tgcggcatcgatttgtccttcacgcccgtcttagatttggactggggaaactgccccgtc
atcggcaaccgcagtttccaccgcaatcccgaagcggtcgcccgccttgccctcgccctt
caaaaaggtttggaaaaaggcggtatgaaatcctgcggtaaacattttcccggacacgga
tttgtcgaaggagacagccatttggtgctacccgaagacgggcgcagcctgtccgaactc
gaagccgccgacctcgcccccttccgcattatgagccgcgaaggtatggcagcggttatg
cccgcccacgtcgtttatccgcaagtggacacaaagcccgcagggttttccgaaatctgg
ctcaaacaaattttgcgccgcgacatcgggtttaaaggcgtaattttctcggatgatttg
actatggagggcgcgtgcggggcaggcggcatcaaagaacgcgcccgcatttcctttgag
gcaggttgcgacatcgtcctcgtctgcaaccgtcccgaccttgtggacgaactgcgcgaa
gatttccgcattcccgacaatcccgctttggcgcaacgttggcaatatatggccaacacg
ctcggcagtgccgccgcgcaagccgtgatgcaaacaacggatttccaagcggcgcaagcc
tttgttgccggccttgcctcgccgcaggacacggcgggcggcgtgaaagtcggagaggcc
ttttaa

DBGET integrated database retrieval system