KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0468Help
Entry
NMCC_0468         CDS       T00633                                 

Definition
beta-hexosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    NMCC_0468
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    NMCC_0468
Enzymes [BR:nmn01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     NMCC_0468
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(486631..487716)
Genome map
AA seq 361 aa AA seqDB search
MTVPCIPRGLVMADIAAFRLTEEEKQRLLDPAVGGVILFRRNFQNIAQLKELTAEIKALR
TPELIIAVDHEGGRVQRFIEGFTRLPAMSTLGEIWDKDGASAAETAAGQVGRVLATELSA
CGIDLSFTPVLDLDWGNCPVIGNRSFHRNPEAVARLALALQKGLEKGGMKSCGKHFPGHG
FVEGDSHLVLPEDGRSLSELEAADLAPFRIMSREGMAAVMPAHVVYPQVDTKPAGFSEIW
LKQILRRDIGFKGVIFSDDLTMEGACGAGGIKERARISFEAGCDIVLVCNRPDLVDELRE
DFRIPDNPALAQRWQYMANTLGSAAAQAVMQTTDFQAAQAFVAGLASPQDTAGGVKVGEA
F
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atgactgttccctgtattccgcgcggcctcgtcatggccgacattgccgccttccgcctg
accgaagaggaaaagcaacgccttctcgatcccgccgtcggcggagtcatcctgttccgc
cgcaacttccaaaatatcgcacagctcaaagaactcaccgccgaaatcaaagccctgcgc
acacccgaactcattatcgccgtcgatcacgaaggcggcagggtgcaacgtttcatcgaa
ggcttcacccgcctgcccgcaatgagtacgctcggcgagatttgggacaaagacggcgcg
tccgccgccgaaaccgccgccggacaagtcggccgggttttggcaaccgagctttccgcc
tgcggcatcgatttgtccttcacgcccgtcttagatttggactggggaaactgccccgtc
atcggcaaccgcagtttccaccgcaatcccgaagcggtcgcccgccttgccctcgccctt
caaaaaggtttggaaaaaggcggtatgaaatcctgcggtaaacattttcccggacacgga
tttgtcgaaggagacagccatttggtgctacccgaagacgggcgcagcctgtccgaactc
gaagccgccgacctcgcccccttccgcattatgagccgcgaaggtatggcagcggttatg
cccgcccacgtcgtttatccgcaagtggacacaaagcccgcagggttttccgaaatctgg
ctcaaacaaattttgcgccgcgacatcgggtttaaaggcgtaattttctcggatgatttg
actatggagggcgcgtgcggggcaggcggcatcaaagaacgcgcccgcatttcctttgag
gcaggttgcgacatcgtcctcgtctgcaaccgtcccgaccttgtggacgaactgcgcgaa
gatttccgcattcccgacaatcccgctttggcgcaacgttggcaatatatggccaacacg
ctcggcagtgccgccgcgcaagccgtgatgcaaacaacggatttccaagcggcgcaagcc
tttgttgccggccttgcctcgccgcaggacacggcgggcggcgtgaaagtcggagaggcc
ttttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system