KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0488Help
Entry
NMCC_0488         CDS       T00633                                 

Gene name
adhP
Definition
(GenBank) alcohol dehydrogenase, propanol-preferring
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00010  Glycolysis / Gluconeogenesis
nmn00071  Fatty acid degradation
nmn00350  Tyrosine metabolism
nmn00625  Chloroalkane and chloroalkene degradation
nmn00626  Naphthalene degradation
nmn01100  Metabolic pathways
nmn01110  Biosynthesis of secondary metabolites
nmn01120  Microbial metabolism in diverse environments
nmn01130  Biosynthesis of antibiotics
nmn01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMCC_0488 (adhP)
  Lipid metabolism
   00071 Fatty acid degradation
    NMCC_0488 (adhP)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMCC_0488 (adhP)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMCC_0488 (adhP)
   00626 Naphthalene degradation
    NMCC_0488 (adhP)
Enzymes [BR:nmn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMCC_0488 (adhP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 CoA_binding Methyltransf_25 TrkA_N DUF2237 Methyltransf_31
Motif
Other DBs
NCBI-ProteinID: ABX72689
UniProt: A9M214
Position
complement(507556..508602)
Genome map
AA seq 348 aa AA seqDB search
MKMQAVVVNKNVAGDVEIVEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVL
GHEGIGLVKEVADGVKNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGG
MATHCIVSADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSGVRPGQWIAIYGAGGLGNL
GVQYAKKVFGAHVVAIDINDDKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHAAVVTA
VSAAAFNSAVNCVRAGGRVVAIGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQF
GAEGLVVPKVELRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaaatagtcgaa
cgcgaggttcgcccgttggaatacggcgaggcgttggtcgaagtcgaatattgcggcgtg
tgccacaccgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgctg
ggacacgagggcatcggtttggttaaagaagttgccgacggtgtgaaaaatctgaaagtc
ggcgaccgcgtcagcatcgcctggctgttccaaagctgcggctcgtgcgaatactgcaat
accggccgcgaaaccctgtgccgctctgtattgaacgcgggctacaccgccgacggcggt
atggcgacccactgcatcgtgagtgccgattacgcggtcaaagtccctgaaggtttggat
cctgcgcaagcttcgagcattacttgtgccggcgtgaccacttataaagccattaaagtt
tccggcgttcgtccgggacagtggattgccatctacggcgcgggcggtttgggcaacttg
ggggtccaatacgcgaaaaaagtattcggcgcgcacgttgtcgccatcgacatcaacgac
gacaaactggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagag
gacgctgccaaagtgattcaggaaaaaaccggcggcgcacacgctgcggtcgtaaccgcc
gtatctgctgccgcattcaactctgccgtgaattgcgtccgcgcgggcggacgtgtggtt
gccatcgggctgccgccggaatcgatggatttgtccatcccgcgtttggttttggacggc
atcgaagtggtcggctctttggtcggcacgcgcaaagatttggaagaagccttccaattc
ggcgcggaaggtttggttgtgcctaaagtcgagttgcgtgctttggatgaagcgcctgcc
atcttccaagaaatgcgcgaaggtaaaattaccggccgtatggtgattgatatgaaaaaa
gaatgcggctgcggccatcaccactga

DBGET integrated database retrieval system