KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0492Help
Entry
NMCC_0492         CDS       T00633                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Brite
Enzymes [BR:nmn01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NMCC_0492 (dsbC)
Secretion system [BR:nmn02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NMCC_0492 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(513094..513918)
Genome map
AA seq 274 aa AA seqDB search
MIQFRFSNTRNHLYMKTKLIKILTPFTVLPLLACGQTPVSNANAEPAVKAESAGKSVAAS
LKARLEKTYSAQDLKVLSVSETPVKGIYEVVVSGRQIIYTDAEGGYMFVGELINIDTRKN
LTEERAADLNKIDFASLPLDKAIKEVRGNGKLKVAVFSDPDCPFCKRLEHEFEKMTDVTV
YSFMMPIAGLHPDAARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQ
FGFNGTPTLVFPNGRSQSGYSPMPQLEEIIRKNQ
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
ttgatacaattccgcttttccaacacgcgcaatcatctttatatgaaaaccaagttaatc
aaaatcttgaccccctttaccgtcctcccactgctggcttgcgggcaaacgcccgtttcc
aatgccaacgccgaacccgccgtcaaagccgagtccgccggcaaatccgttgccgcctct
ttgaaagcgcgtttggaaaaaacctattccgcccaagatttgaaagtgttgagcgtcagc
gaaacaccggtcaaaggcatttacgaagtcgtcgtcagcggcaggcagattatctacacc
gatgccgaaggcggctatatgttcgtcggcgaactcatcaacatcgacacgcgcaaaaac
ctgaccgaagaacgcgccgccgatttgaacaaaatcgacttcgcctccctgcctttggac
aaagccatcaaagaagtgcgcggcaacggcaagctgaaagtcgccgtcttctccgacccc
gattgtccgttctgcaaacgcttggaacacgagtttgaaaaaatgaccgacgtgacggtt
tacagctttatgatgcccattgccggcctgcaccccgatgccgcgcgcaaggcgcaaatc
ttatggtgtcagcccgaccgcgccaaagcgtggacggattggatgcgtaaaggcaaattc
ccggtcggcggcagcatctgcgacaatcccgtcgcggaaaccacttccttgggcgaacaa
ttcggcttcaacggcacgccgaccctcgtcttccccaacgggcgcagccaaagcggctac
agcccgatgccccaactggaggaaatcatccgcaaaaatcaataa

DBGET integrated database retrieval system