KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0586Help
Entry
NMCC_0586         CDS       T00633                                 

Gene name
galU
Definition
(GenBank) UTP--glucose-1-phosphate uridylyltransferase
  KO
K00963  UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00040  Pentose and glucuronate interconversions
nmn00052  Galactose metabolism
nmn00500  Starch and sucrose metabolism
nmn00520  Amino sugar and nucleotide sugar metabolism
nmn01100  Metabolic pathways
nmn01130  Biosynthesis of antibiotics
Module
nmn_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    NMCC_0586 (galU)
   00052 Galactose metabolism
    NMCC_0586 (galU)
   00500 Starch and sucrose metabolism
    NMCC_0586 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    NMCC_0586 (galU)
Enzymes [BR:nmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     NMCC_0586 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 CTP_transf_3 Glycos_transf_2 IspD
Motif
Other DBs
NCBI-ProteinID: ABX72784
UniProt: A9M2R5
Position
complement(610718..611587)
Genome map
AA seq 289 aa AA seqDB search
MKPIRKAVFPVAGMGTRFLPATKASPKEMLPIVDKPLIQYAVEEAVEAGCTEMVFVTGRN
KRSIEDHFDKAYELETELEMRHKDKLLEHVRNILPPNITCLYIRQAEALGLGHAVLCARA
AIGDEPFAVILADDLIDAPKGALKQMVEVYGRSGNSILGVETVEASQTGSYGIVETEQLK
QFQRITGIVEKPKPEDAPSNLAVVGRYILTPRIFDLLTNLPRGAGNEIQLTDGIAKLLDH
EFVLAHPFEGTRYDCGSKLGYLEATVAYGLKHPETGEPFRRLLEKYRTE
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
atgaaacccatacggaaagccgttttccccgtcgcagggatgggaacccgcttcctgccc
gccaccaaggccagcccgaaagaaatgctgcccatcgtcgacaagccgctgatccaatac
gccgtagaagaagccgtggaagccggctgcacggaaatggtgtttgttaccggacgcaac
aaacgcagcatcgaagaccatttcgacaaggcatacgaactcgaaaccgagttggaaatg
cgccataaagacaaattgttggaacacgtccgcaacatcctgccgccgaacattacctgc
ctctacatccgtcaggcggaagcactgggcttgggacacgccgtcttgtgcgcccgcgcc
gccatcggagacgaaccctttgccgttatccttgccgacgacctgattgatgcccccaaa
ggcgcgctcaaacaaatggtcgaagtgtacgggcgcagcggcaacagcattttgggcgta
gaaaccgttgaagcatcgcaaaccggctcatacggcatcgtcgaaaccgaacagctcaaa
cagttccaacgcattaccggcattgtcgaaaaacccaagcccgaagacgcgccctccaac
cttgccgttgttggacgctacatcctcaccccgcgcattttcgacctcttaaccaatctt
ccgcgcggcgcgggcaacgaaatccagcttacagacggcatcgccaagctgctcgatcac
gaatttgtcctggcgcacccctttgaaggtacgcgctacgactgcggcagcaaactgggc
tacctcgaagccaccgtcgcctacggtctgaaacatcccgaaaccggcgaacccttccgc
cggcttttggaaaaataccgcaccgaataa

DBGET integrated database retrieval system