KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0634Help
Entry
NMCC_0634         CDS       T00633                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase alpha chain
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00260  Glycine, serine and threonine metabolism
nmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmn01100  Metabolic pathways
nmn01110  Biosynthesis of secondary metabolites
nmn01130  Biosynthesis of antibiotics
nmn01230  Biosynthesis of amino acids
Module
nmn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMCC_0634 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMCC_0634 (trpA)
Enzymes [BR:nmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMCC_0634 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA PcrB His_biosynth Peripla_BP_6 ZnuA
Motif
Other DBs
NCBI-ProteinID: ABX72830
UniProt: A9M2W1
Position
647080..647817
Genome map
AA seq 245 aa AA seqDB search
MIPYITVGDPDIRTTLALMHGMVANGADILELGVPFSDPMADGPVIQRAAERALANGISL
RDVLDVVRKFRETDTQTPVVLMGYLNPVHKMGYREFAQEAAKAGVDGVLTVDSPVETIDP
LYRELKDNGVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGVTGAASLDTDEVSRKIE
YLHQYIDIPIGVGFGISNAESARKIGRVADAVIVGSRIVKEIENNAGNEAAAVGALVKEL
KDAVR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
ttgattccctatattacggtgggcgaccccgatattcggacaactttggcattgatgcat
ggcatggttgcaaacggtgcggatattttagagttgggcgtgccgttttccgatccgatg
gcggacgggccggttattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctg
cgcgatgtcttggatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgtt
ttgatgggatatttgaaccctgtacataagatgggttatcgggagtttgctcaggaagcc
gcaaaggcgggtgtggacggcgtgttgacggtggattcccctgtcgaaaccatcgatccg
ctctatcgcgagctgaaggataacggggtcgactgtattttcctgattgcgccgacgacg
acggaagaccgtattaaaaccattgccgagctggcaggcggatttgtctattatgtttcg
ctcaagggcgtaacgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagag
tatttgcatcagtatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaa
agcgcgcgcaaaatcggccgggttgccgacgcggtcattgtcggcagccggattgtgaaa
gagattgaaaacaatgcgggcaacgaggctgccgccgtcggtgctttggtcaaagagttg
aaggatgccgtgcgctga

DBGET integrated database retrieval system