KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0634Help
Entry
NMCC_0634         CDS       T00633                                 

Gene name
trpA
Definition
tryptophan synthase subunit alpha
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMCC_0634 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMCC_0634 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMCC_0634 (trpA)
Enzymes [BR:nmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMCC_0634 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
647080..647817
Genome map
AA seq 245 aa AA seqDB search
MIPYITVGDPDIRTTLALMHGMVANGADILELGVPFSDPMADGPVIQRAAERALANGISL
RDVLDVVRKFRETDTQTPVVLMGYLNPVHKMGYREFAQEAAKAGVDGVLTVDSPVETIDP
LYRELKDNGVDCIFLIAPTTTEDRIKTIAELAGGFVYYVSLKGVTGAASLDTDEVSRKIE
YLHQYIDIPIGVGFGISNAESARKIGRVADAVIVGSRIVKEIENNAGNEAAAVGALVKEL
KDAVR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
ttgattccctatattacggtgggcgaccccgatattcggacaactttggcattgatgcat
ggcatggttgcaaacggtgcggatattttagagttgggcgtgccgttttccgatccgatg
gcggacgggccggttattcagcgtgcggcggagcgggcgttggcaaacgggatttcgctg
cgcgatgtcttggatgtcgtcagaaaattccgtgaaaccgacacgcaaacgccggttgtt
ttgatgggatatttgaaccctgtacataagatgggttatcgggagtttgctcaggaagcc
gcaaaggcgggtgtggacggcgtgttgacggtggattcccctgtcgaaaccatcgatccg
ctctatcgcgagctgaaggataacggggtcgactgtattttcctgattgcgccgacgacg
acggaagaccgtattaaaaccattgccgagctggcaggcggatttgtctattatgtttcg
ctcaagggcgtaacgggcgcggcaagtttggatacggatgaggtttcgcgtaaaatagag
tatttgcatcagtatatcgatattcccatcggtgtcggtttcggcatcagcaatgcggaa
agcgcgcgcaaaatcggccgggttgccgacgcggtcattgtcggcagccggattgtgaaa
gagattgaaaacaatgcgggcaacgaggctgccgccgtcggtgctttggtcaaagagttg
aaggatgccgtgcgctga

DBGET integrated database retrieval system