KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0658Help
Entry
NMCC_0658         CDS       T00633                                 

Gene name
trpB
Definition
tryptophan synthase subunit beta
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nmn01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:nmn00260]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nmn00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
665618..666820
Genome map
AA seq 400 aa AA seqDB search
MKNYHAPDEKGFFGEHGGLYVSETLIPALQELADAYKAAKNDPEFWAEFRCDLKHYVGRP
SPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQH
GVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVESGSRTLKDAMNEAMR
EWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEAIGRQPDVAVACVGGGS
NAIGLFHPYIGEENVRLVGVEAGGLGVNTPDHAAPITSGAPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALEAFDLLCRFEGIIPALESSHA
VAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactaccacgcgcccgacgagaagggctttttcggcgaacacggcgggctttat
gtttccgagaccctgattcccgccttgcaagagctggcggatgcctataaggcagcgaaa
aacgatcctgaattttgggcggagtttcgctgcgatttgaaacattatgtcggcaggccc
agccccgtttaccacgccgcgcggttgtccgagcatttgggcggcgcgcaaatctggttg
aagcgcgaagacttgaaccacaccggcgcgcacaaagtcaacaacaccatcggtcaggca
ctgttggcaaaacgcatgggtaaaaaacgcgtcatcgccgaaaccggcgcgggtcagcac
ggcgtggcgagtgccaccgttgccgcacgcttcggtatgacttgcgacgtgtatatgggc
gcggacgacatccaacgccaaatgcccaacgtgttccgtatgaaattattgggcgcgaac
gtggtcggtgtagaaagcggcagccgcacgctgaaagacgcgatgaacgaagccatgcgc
gaatgggtcgcccgcgtggacgacacgttctacatcatcggtaccgccgccggccccgcg
ccgtatcccgaaatggtgcgcgatttccaatgcgtgattggcaacgaagctaaagcgcag
atgcaggaagccatcggcagacagcccgacgttgccgttgcctgcgtgggcggcggatcg
aacgccatcggtttgttccacccgtatatcggcgaagaaaacgtgcgcctcgtcggcgtg
gaggctggcggtttgggcgtgaacacccccgatcacgccgcgccgattacttcgggcgca
ccgattggcgtattgcacggtttccgcagctatctgatgcaggacgaaaacggtcaggtt
ttgggtacgcactctgtttccgcaggcttggattaccccggcatcggcccggaacacagc
catctgcacgacatcaagcgcgtcgaatacactgttgccaaagacgacgaagcactcgaa
gcctttgacttgctctgccgcttcgagggcatcatccccgcgctcgaatccagccacgcc
gttgcttgggcggtgaaaaatgcgccgaaaatgggtaaagaccaagtgattttggtcaac
ctctcaggtcgtggcgacaaagacatcaataccgtcgcgaagctcaaagggattaaactg
taa

DBGET integrated database retrieval system