KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0658Help
Entry
NMCC_0658         CDS       T00633                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase beta chain
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00260  Glycine, serine and threonine metabolism
nmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmn01100  Metabolic pathways
nmn01110  Biosynthesis of secondary metabolites
nmn01130  Biosynthesis of antibiotics
nmn01230  Biosynthesis of amino acids
Module
nmn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMCC_0658 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMCC_0658 (trpB)
Enzymes [BR:nmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMCC_0658 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ABX72854
UniProt: A9M354
Position
665618..666820
Genome map
AA seq 400 aa AA seqDB search
MKNYHAPDEKGFFGEHGGLYVSETLIPALQELADAYKAAKNDPEFWAEFRCDLKHYVGRP
SPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQH
GVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVESGSRTLKDAMNEAMR
EWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKAQMQEAIGRQPDVAVACVGGGS
NAIGLFHPYIGEENVRLVGVEAGGLGVNTPDHAAPITSGAPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALEAFDLLCRFEGIIPALESSHA
VAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagaactaccacgcgcccgacgagaagggctttttcggcgaacacggcgggctttat
gtttccgagaccctgattcccgccttgcaagagctggcggatgcctataaggcagcgaaa
aacgatcctgaattttgggcggagtttcgctgcgatttgaaacattatgtcggcaggccc
agccccgtttaccacgccgcgcggttgtccgagcatttgggcggcgcgcaaatctggttg
aagcgcgaagacttgaaccacaccggcgcgcacaaagtcaacaacaccatcggtcaggca
ctgttggcaaaacgcatgggtaaaaaacgcgtcatcgccgaaaccggcgcgggtcagcac
ggcgtggcgagtgccaccgttgccgcacgcttcggtatgacttgcgacgtgtatatgggc
gcggacgacatccaacgccaaatgcccaacgtgttccgtatgaaattattgggcgcgaac
gtggtcggtgtagaaagcggcagccgcacgctgaaagacgcgatgaacgaagccatgcgc
gaatgggtcgcccgcgtggacgacacgttctacatcatcggtaccgccgccggccccgcg
ccgtatcccgaaatggtgcgcgatttccaatgcgtgattggcaacgaagctaaagcgcag
atgcaggaagccatcggcagacagcccgacgttgccgttgcctgcgtgggcggcggatcg
aacgccatcggtttgttccacccgtatatcggcgaagaaaacgtgcgcctcgtcggcgtg
gaggctggcggtttgggcgtgaacacccccgatcacgccgcgccgattacttcgggcgca
ccgattggcgtattgcacggtttccgcagctatctgatgcaggacgaaaacggtcaggtt
ttgggtacgcactctgtttccgcaggcttggattaccccggcatcggcccggaacacagc
catctgcacgacatcaagcgcgtcgaatacactgttgccaaagacgacgaagcactcgaa
gcctttgacttgctctgccgcttcgagggcatcatccccgcgctcgaatccagccacgcc
gttgcttgggcggtgaaaaatgcgccgaaaatgggtaaagaccaagtgattttggtcaac
ctctcaggtcgtggcgacaaagacatcaataccgtcgcgaagctcaaagggattaaactg
taa

DBGET integrated database retrieval system