KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0741Help
Entry
NMCC_0741         CDS       T00633                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:nmn00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
743349..744089
Genome map
AA seq 246 aa AA seqDB search
MLIVRPSGRAKDDVETCRRAGWQAEVLSPIEIEADAAGLELLSEQYARADAVFWVSPTAV
ETAVPYLNLSDGIKMHISVGQGSRRVLERCLGRTVIAPEDGNDSEAVLRLTVWNSLPEGA
RVLFVRGHGGRDFLMNALQEKGFRTEVAEVYFRRHKPLNFQNFQTENIAAAYITSTELVR
LLFGQLPPQFSRFFKSLLYFTHHPRIAEALKREGVCSVETVPTLEAALSHSSISVSDGMV
FPGTSN
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgctgattgtccgaccgtcgggcagggcgaaggacgatgtggaaacctgccgtcgtgcc
ggatggcaggcggaagtgttgagcccgattgaaatcgaagcagatgctgccggactggaa
cttttgtccgaacaatatgcccgtgcggatgccgtgttttgggtcagtccgaccgccgtt
gaaaccgccgtcccgtaccttaacctttcagacggcataaagatgcacatttccgtaggg
cagggcagccgccgcgtattggaacgctgtttgggcagaacggtcatcgcgcctgaagac
ggcaacgacagcgaggcggttttgcgcctgacggtttggaacagtctgcccgaaggtgcg
cgcgtattgtttgtgcgcggacacggcgggcgggattttctgatgaatgccttgcaggag
aaaggttttcggacggaggtggcagaagtctatttcagacggcataaacctttgaacttt
caaaatttccaaaccgaaaatattgccgccgcctatattacgtccacagaactcgtgcgc
ttgctgttcggacagcttccgccgcaattttcccgattcttcaaatccttgctatacttt
acccatcatccgcgcattgcggaggcattgaagcgcgaaggcgtgtgttcggtcgaaacc
gtccctacgctggaagccgcgctttcccattcttccatttccgtttcagacggcatggtc
tttcccggaacctcaaattaa

DBGET integrated database retrieval system