KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0833Help
Entry
NMCC_0833         CDS       T00633                                 

Gene name
ipk
Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMCC_0833 (ipk)
Enzymes [BR:nmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     NMCC_0833 (ipk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
837929..838774
Genome map
AA seq 281 aa AA seqDB search
MNIADGRQAFPAPAKLNLDLRITGRREDGYHNIESIFCLIDLQDTVYLKPRDDGKIILHN
PVGGIPQEADLSYRAASLLQKYARNPAGVEIWLDKKIPTGAGLGGGSSDAATVLLVLNRW
WQCSRTTQQLIDLGATLGADVPFFIFGKNAFASGIGEKLIGMDIPKQWYVIVKPPVHVST
AKIFTHEGLTRNSASSIMPTFQNLQPFRNDMQAVVFKEYPEVWKAYSELSRYGFALMTGS
GACVFTACQDRDSAYNIYRQVSGLYEAYLAEGLSKHPLLSV
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgaatattgcggacggacggcaggcgtttcccgcacctgcaaaactgaatctcgatttg
aggattaccggcaggcgggaagacggttatcacaatatcgaaagcatattctgcctgata
gatttgcaggataccgtatatttgaaaccgagggacgacggcaaaatcatcctgcacaat
cctgtcggcggaataccgcaggaagccgatttgagctaccgtgccgcatcgttgctgcaa
aaatatgcgcgcaaccccgccggcgtggaaatatggctggacaaaaaaatcccgacaggg
gcgggtttgggcggcggaagctcggatgcggcaaccgttttgctggtgttgaaccgttgg
tggcagtgttcccgaacgacgcagcagctgattgacttgggcgcaactttgggtgcggac
gtaccattttttattttcgggaaaaatgcttttgcaagcgggataggtgaaaaactgata
ggaatggatattccgaaacagtggtatgtcatcgtcaaaccgcccgtccacgtttccact
gcaaaaattttcacacacgaaggcttgacacgaaattccgcctcaagcataatgccgact
ttccaaaacctgcaaccgtttagaaatgatatgcaggcagttgtatttaaagaataccct
gaagtttggaaagcctattccgaattgtcccgatatggatttgccttaatgacaggttct
ggtgcgtgtgtattcacggcgtgtcaagatagggatagcgcatacaatatataccgacaa
gtttcaggtttgtacgaggcatatttggcagagggtctttcaaaacatcctttgttgtcc
gtataa

DBGET integrated database retrieval system