KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0893Help
Entry
NMCC_0893         CDS       T00633                                 

Gene name
sdhD
Definition
succinate dehydrogenase hydrophobic membrane anchor protein
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Class
Metabolism; Overview; Carbon metabolism [PATH:nmn01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:nmn00020]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:nmn00650]
Metabolism; Energy metabolism; Oxidative phosphorylation [PATH:nmn00190]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
893233..893574
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWVMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSVKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggtgatgcaacgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctattttccctg
cctaaagaatattcggcatggcaggcattttttagtcaaacttgggtaaaagtatttacc
caagtgagcttcatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccatcgtttggctg
gtcggctgtctcgtgtattcagttaaagtgatttgggggtaa

DBGET integrated database retrieval system