KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0893Help
Entry
NMCC_0893         CDS       T00633                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00020  Citrate cycle (TCA cycle)
nmn00190  Oxidative phosphorylation
nmn00650  Butanoate metabolism
nmn01100  Metabolic pathways
nmn01110  Biosynthesis of secondary metabolites
nmn01120  Microbial metabolism in diverse environments
nmn01130  Biosynthesis of antibiotics
nmn01200  Carbon metabolism
Module
nmn_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmn_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmn_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMCC_0893 (sdhD)
   00650 Butanoate metabolism
    NMCC_0893 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    NMCC_0893 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: ABX73075
UniProt: A9M4E9
Position
893233..893574
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWVMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSVKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggtgatgcaacgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctattttccctg
cctaaagaatattcggcatggcaggcattttttagtcaaacttgggtaaaagtatttacc
caagtgagcttcatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccatcgtttggctg
gtcggctgtctcgtgtattcagttaaagtgatttgggggtaa

DBGET integrated database retrieval system