KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0987Help
Entry
NMCC_0987         CDS       T00633                                 

Gene name
proB
Definition
glutamate 5-kinase
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Arginine and proline metabolism
Carbapenem biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMCC_0987 (proB)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NMCC_0987 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NMCC_0987 (proB)
Enzymes [BR:nmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NMCC_0987 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(987889..988752)
Genome map
AA seq 287 aa AA seqDB search
MEEYTANLSSDGIVSAQILLSRADFADKRRYQNAGGALSVLLQRRAVPIINENDTVSVEE
LKIGDNDTLSAQVAAMIQADLLVLLTDIDGLYTGNPNSNPDAVRLDKIEHINHEIIEMAG
GSGSANGTGGMLTKIKAATIAAESGVPVYICSSLKPDALAEAAEHQADGSFFVPRAKGLR
TQKQWLAFYSESRGSVYVDEGAEHALSEQGKSLLMSGIAGIEGHFSRMDTVTVYSKATKQ
PLGKGRVLFGSAAAEDLLKSRKAKGVFIHRDDWISITPEIRLLLTEF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatatacggcaaacctgtcttcagacggcatcgtgtccgcgcaaatcctgctc
agccgcgccgactttgccgacaaacgccgctaccaaaatgccggcggcgcactttccgtg
ctgctgcaacgccgcgccgtccccatcatcaatgaaaacgatacggtttcggttgaggaa
ttgaaaatcggcgacaacgacacattgagtgcgcaagtggcggcgatgatacaggcagac
ctcttggtgctgctgaccgacatagacggtctttacacgggcaacccgaacagcaatccc
gatgccgtacggctggacaaaatcgaacacatcaaccatgaaatcatcgaaatggcgggc
ggatcgggttcggcaaacggcacgggcggtatgctgaccaaaatcaaagcggcaaccatc
gccgccgaatccggcgtaccggtgtatatctgttcctcgctcaaacccgatgcacttgcc
gaagctgccgaacatcaggcggacggctcgtttttcgtcccccgtgccaaaggtttgcgg
acgcagaagcaatggctggcgttctattccgaaagccggggcagcgtttatgtggacgaa
ggtgcggaacacgctttgtccgaacaggggaaaagcctgctgatgtcgggcattgccgga
atcgaagggcatttttcccgtatggacaccgtaaccgtgtacagcaaggcaaccaaacag
cccctgggcaaagggcgcgtcctgttcggttctgccgccgccgaagacctgctcaaatcg
cgtaaggcgaaaggcgtgttcatccatcgggacgactggatttccatcacgcccgaaata
cgcctgcttctgaccgaattttag

DBGET integrated database retrieval system