KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_0987Help
Entry
NMCC_0987         CDS       T00633                                 

Gene name
proB
Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00330  Arginine and proline metabolism
nmn00332  Carbapenem biosynthesis
nmn01100  Metabolic pathways
nmn01130  Biosynthesis of antibiotics
nmn01230  Biosynthesis of amino acids
Module
nmn_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    NMCC_0987 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    NMCC_0987 (proB)
Enzymes [BR:nmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     NMCC_0987 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: ABX73167
UniProt: A9LYZ0
Position
complement(987889..988752)
Genome map
AA seq 287 aa AA seqDB search
MEEYTANLSSDGIVSAQILLSRADFADKRRYQNAGGALSVLLQRRAVPIINENDTVSVEE
LKIGDNDTLSAQVAAMIQADLLVLLTDIDGLYTGNPNSNPDAVRLDKIEHINHEIIEMAG
GSGSANGTGGMLTKIKAATIAAESGVPVYICSSLKPDALAEAAEHQADGSFFVPRAKGLR
TQKQWLAFYSESRGSVYVDEGAEHALSEQGKSLLMSGIAGIEGHFSRMDTVTVYSKATKQ
PLGKGRVLFGSAAAEDLLKSRKAKGVFIHRDDWISITPEIRLLLTEF
NT seq 864 nt NT seq  +upstreamnt  +downstreamnt
atggaagaatatacggcaaacctgtcttcagacggcatcgtgtccgcgcaaatcctgctc
agccgcgccgactttgccgacaaacgccgctaccaaaatgccggcggcgcactttccgtg
ctgctgcaacgccgcgccgtccccatcatcaatgaaaacgatacggtttcggttgaggaa
ttgaaaatcggcgacaacgacacattgagtgcgcaagtggcggcgatgatacaggcagac
ctcttggtgctgctgaccgacatagacggtctttacacgggcaacccgaacagcaatccc
gatgccgtacggctggacaaaatcgaacacatcaaccatgaaatcatcgaaatggcgggc
ggatcgggttcggcaaacggcacgggcggtatgctgaccaaaatcaaagcggcaaccatc
gccgccgaatccggcgtaccggtgtatatctgttcctcgctcaaacccgatgcacttgcc
gaagctgccgaacatcaggcggacggctcgtttttcgtcccccgtgccaaaggtttgcgg
acgcagaagcaatggctggcgttctattccgaaagccggggcagcgtttatgtggacgaa
ggtgcggaacacgctttgtccgaacaggggaaaagcctgctgatgtcgggcattgccgga
atcgaagggcatttttcccgtatggacaccgtaaccgtgtacagcaaggcaaccaaacag
cccctgggcaaagggcgcgtcctgttcggttctgccgccgccgaagacctgctcaaatcg
cgtaaggcgaaaggcgtgttcatccatcgggacgactggatttccatcacgcccgaaata
cgcctgcttctgaccgaattttag

DBGET integrated database retrieval system