KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1118Help
Entry
NMCC_1118         CDS       T00633                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMCC_1118 (recR)
DNA repair and recombination proteins [BR:nmn03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NMCC_1118 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1105122..1105739)
Genome map
AA seq 205 aa AA seqDB search
MSHKKQDAFQGLIDALKVLPNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVHHCA
MCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNMEAANCHDGLYFVLMGQINTALGMD
VSAIALDRLAQRLGGGEVEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLGG
ELEYVDAGTLAQAVYERRLIKEGGA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgagccacaaaaaacaagatgccttccaaggattgatcgacgcgctgaaggttttaccc
aacgtcgggccgaaatcggcacagcggatagcgtatcatttgctccaacacaagcgcaaa
gaggctgaaaaactggtggatgccttgcagacggcattgaagcaggttcaccattgcgcg
atgtgcaacacgttttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgcgac
gggcggcggctgatggtggtgcatatgcctgccgacgtgtcgaatatggaagcggcaaac
tgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatggac
gtatccgccatcgcattggacaggctggcgcaacggctgggcggcggggaagtcgaagaa
atcattattgcaaccgcttttaccgcagaaggcaatgcgacggcgtatgtcctgtccgag
ttttttaaaaacctgccttacaaagtcagcaggctgtcgcagggcatccccttgggcggc
gaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacgccgcctgatt
aaagaaggcggggcataa

DBGET integrated database retrieval system