KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1149Help
Entry
NMCC_1149         CDS       T00633                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMCC_1149 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMCC_1149 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMCC_1149 (thrC)
Enzymes [BR:nmn01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NMCC_1149 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1137817..1139226
Genome map
AA seq 469 aa AA seqDB search
MKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRETLDKWRGLAYPELAFEIMR
LFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKIQALSNGPTLAFKDMAMQFL
GNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNVFMLSPDGKMSAFQRAQMYS
LQDENIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVNSINWGRIVAQVVYYFAGYF
KATQSNDEQVSFCVPSGNFGNVCAGHIAKQMGLPIRRLIVATNENDVLDEFFKTGAYRPR
NSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTLWAEVAAGKGFDLRFALEKVGG
KYGFTSGKSTHPDRLATIRQVYEQDQELIDPHTADGVKVAREVREEGETVVCLETALAAK
FDATIREAVGDAAIPRPAALEGLETLPQRVQTVPNSADAVKGIIEQTLA
NT seq 1410 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattg
atggggcttgcacccgacggcggcctgatgctgccggaacattatccgcaaatcgggcgc
gaaaccttggacaaatggcgcggtttggcttatcccgaattggcgtttgaaattatgcgc
ctgtttgttacggatattccggaggacgatttgcgcgacattctgaaccgtacttacacg
gaagcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaa
atccaagccttgtccaacggcccgacgctggcgttcaaagatatggcaatgcagtttttg
ggcaatgcgtttgaatatgttttaaacaaagaaggcaaaaaactcaatatcttgggcgcg
accagcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaagggcgtgaac
gtatttatgttgtcgcccgacggtaaaatgagcgcgttccaacgcgcgcaaatgtacagc
ctgcaagacgagaatatccacaatatcgccgtgaagggaatgtttgacgactgtcaggac
attgtgaaggcggtgcaaaacgatgccgcgttcaaggaaaaataccatatcggtacggtc
aattcgatcaactggggacgcatcgtcgcgcaagtggtttattactttgcaggctatttc
aaagcgacgcaaagcaatgacgagcaagtcagcttctgcgtgccgagcggcaacttcggc
aacgtttgcgcgggacacatcgccaaacagatgggtttgcctatccgccgcctgattgtc
gcgaccaatgaaaacgatgtgttggacgagtttttcaaaaccggtgcataccgcccgcgc
aacagcgcgcatacttatgttacctccagcccgtcgatggacatttccaaagcgtccaac
ttcgagcgtttcgtgttcgacctgatggatcgcgatcctcaggaaatcaatacgctgtgg
gcggaagtagcggcgggcaaaggctttgacctgcggtttgctttagaaaaagtcggtggc
aaatacggttttacctccggcaaatccacccaccccgaccgcctcgccaccatcagacag
gtttatgagcaagaccaagaactcatcgacccgcacactgccgacggcgtaaaagtcgcc
cgcgaagtgcgcgaagaaggggaaacggttgtgtgtttggaaaccgcgttggcagcgaaa
ttcgatgcgaccatacgcgaagccgtcggcgatgccgccattccgcgccccgccgcgctg
gaaggtttggaaacattgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggta
aaaggcatcatcgaacaaacccttgcctga

DBGET integrated database retrieval system