KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1208Help
Entry
NMCC_1208         CDS       T00633                                 

Gene name
fpg
Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:nmn03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1199528..1200355)
Genome map
AA seq 275 aa AA seqDB search
MPELPEVETTLRGIAPHIEGKTVEAVVLRQLKLRWQINPDLGEILSGRQVLSCGRRAKYL
IVRFQTGILLIHLGMSGSLRIFTPSDGRIGRPDRHDHVDIVFSDGTVMRYRDPRKFGAIL
WYEGIEEHHPLLEKLGPEPLSEAFCTDYLYVRLKAQKRAVKLALMDNAVVVGVGNIYANE
SLFRAGISPHRPANRLKKKECALLVETVKAVLRRAIETGGSTLRDFVDSDGKSGYFQQEY
TVYGRHNQPCPQCGGLVVKETLGQRGTFYCPNCQK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgccggaattgccggaagtggaaacgacgttgcgcggcatcgcgccgcatattgaaggg
aaaacggtggaagccgtggtattgcgccaattgaagctgcgctggcagatcaatcccgat
ttgggggagattttgtccggtcggcaggttttgtcctgcggcaggcgtgccaaatatctg
attgtccgtttccaaacggggattttgctgattcacttggggatgtcgggcagcttgcgg
atttttacgccgtcggacggacgtatcggcaggccggacagacacgatcacgtcgatatt
gtgttttcagacggcacggtcatgcgttaccgcgatccgagaaagttcggcgcgatactt
tggtatgagggaatcgaagaacatcatccgctgttggaaaaactggggccggagcctttg
tcggaggcattttgcacggattatctgtatgtgaggctgaaggcgcagaagcgcgcggtc
aaacttgccctgatggacaatgcggtcgtggtcggtgtgggcaatatttatgccaatgag
agcctgttcagagcgggcatttcgccccaccgtcctgccaaccgtctgaaaaagaaagag
tgtgcgcttttggttgaaaccgtcaaagcggtgttgcggcgcgccattgaaacgggcggc
agtaccttgagggattttgtggacagcgacggcaaaagcggctacttccaacaggaatat
acggtgtacgggcggcacaatcagccgtgcccccagtgcggcggtttggttgtgaaagaa
actttggggcagcgcggcacgttttactgcccgaattgtcagaaatag

DBGET integrated database retrieval system