KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1289Help
Entry
NMCC_1289         CDS       T00633                                 

Definition
type III restriction/modification system enzyme
Orthology
K01156  
type III restriction enzyme [EC:3.1.21.5]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Brite
Enzymes [BR:nmn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.21  Endodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.21.5  type III site-specific deoxyribonuclease
     NMCC_1289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1290175..1292958
Genome map
AA seq 927 aa AA seqDB search
MANNKTLFEVIENERKAVKKYKPELLEMPEFTSKNLKYDFFEWQKSALENFLIFDRTSKL
DDFPDLKNKPTHLLFNMATGAGKTMMMAALILYYFEKGYRHFLFFVNQNNIVDKTENNFI
DPTHAKFLFTEKILQGDTVIPIRKVETFSPHSDGIEIKFTSIQKLYNDIHTERENQTTLA
DLHELNLVMLGDEAHHLNAQTKGKKQGELDLEVELKANAGNAEIERKGWEHMVLELLLNK
NGNPSQNVLLEFTATLPENADVQQKYADKIITKFGLKEFLQKGYTKEINLVSSTLGKKER
VLHALLFAWYRHQIALKYGIANFKPVMFFRSKTIDESKADYLAFLNWAENVQAVDFSFLT
TFSTSLNDSDSDNANEQGKTRTEQALKFMQEKGVEFAHLADWVKQNYQKHNVIITNSETN
KTKTEKTDSETEKLLNNLEAADNPIRAIFTVDRLTEGWDVLNLFDIVRLYEGQNGGGSNK
KSGKTAAATVSEKQLIGRGVRYFPFAFEGKQPNKRKFDNDMQHELRILEELFYYTHDEQS
RYISELKNELRKDGYLPEKDDDKVLATFKLKSEFAANKDFRELLIWANKKIPNPNAKTNN
ANSLQANPQTLSFQVHGNQLLQETQFTADENDEKVKQLGTQNNFTQTIKMSEMERHIFNK
ALHIKGKNSQSLFHFDRLQSKLNIQNRNELQNKLLKDWQIEFLGLGQDKQVRLDDKLAGC
LKILEMVEKHLNESDMPFIGTKEFTPKKLWEIFGTPKQKWVKKDDVKTTIATQNDWYVMN
NFAGTGLEEALIQFISARLGDLKSQYDVHLIRNEEVFKLNNFADGEGFMPDFILLLKDKQ
KSSSNGVNDFLHYQIFIEPKGEHLVETDGWKEEFLEAITVEYGMDKILQKDTPHYRLIGL
PFFTDHQKNGQFTESFPLGAASLEKMK
NT seq 2784 nt NT seq  +upstreamnt  +downstreamnt
atggcgaataataaaacgttgtttgaagtgattgaaaatgaacgtaaagcggttaaaaaa
tacaagcctgaattacttgaaatgccagaatttacgtccaaaaacttaaaatatgatttt
tttgaatggcaaaaatctgcccttgaaaactttttgatttttgaccgcacttcaaagcta
gacgatttccctgatttaaaaaataagccaacgcatttgctgttcaatatggcaacaggt
gcaggcaaaacgatgatgatggcggcattgattttgtattattttgaaaaagggtatcgg
cattttctgttttttgtgaatcaaaacaatatcgtggataaaacggaaaataattttatt
gacccgacacacgcaaaatttttatttaccgagaagattttgcagggcgatacggtaatt
cccattcgcaaagtggaaacgttcagcccacattcagacggcattgaaattaaatttacc
agcattcaaaagctgtataacgatattcacaccgaacgggaaaaccaaaccacattggcg
gatttgcacgaattgaatcttgtgatgctgggcgatgaagcacaccatttaaacgcgcaa
accaaaggcaaaaaacaaggcgagttggatttggaagtggaattaaaagccaatgcaggc
aatgccgaaattgaacgcaaaggctgggagcatatggttttggaattgttactcaataaa
aatggcaatcccagccaaaatgtgctgttggaatttaccgccacgctgcctgaaaatgct
gacgtgcaacaaaaatacgcggataaaatcatcacaaaatttggcttaaaagaatttttg
caaaaaggttataccaaagaaatcaatttggtatccagtacgctgggcaagaaagagcgg
gtgttgcacgctttattatttgcttggtatcgccatcaaatcgctttgaaatatggcatt
gccaatttcaagcctgtgatgttctttagaagtaagacgattgatgaatcaaaagcggat
tatctggcatttttaaattgggcagaaaatgtgcaggcggttgatttttcgtttttaact
acattttcaacaagcttgaacgatagcgatagcgataacgccaacgaacaaggcaaaacc
cgcactgaacaagccctaaaatttatgcaggaaaaaggcgttgagtttgcacatttggca
gattgggtaaaacaaaattatcaaaaacacaatgtgattattaccaactccgaaaccaac
aaaaccaaaaccgaaaaaaccgacagcgaaacagaaaaattgctgaataatttggaagcg
gctgataatccgattcgtgccatttttacggtggacagattaaccgaaggttgggacgtt
ctgaatttgtttgatattgtgcgtttgtatgaagggcaaaacggcggcggttcaaataaa
aaatcaggcaaaacggctgccgccaccgtatcggaaaagcagttgattggtcgtggcgtg
cgttattttccatttgcgtttgaaggtaaacagccgaataaacgcaaatttgacaacgat
atgcaacacgaattgcgtatcttggaagaattgttttattacacgcacgatgagcaatcc
cgctatatttcagaactgaaaaacgagttgcgaaaagacggttatttgcctgaaaaagac
gatgataaggtattggcaacatttaaactcaaatctgaatttgccgctaataaggatttt
agagaattgttaatttgggcgaataaaaaaatccccaacccaaacgccaaaaccaataat
gcaaacagcctgcaagccaatccgcaaacgctttcattccaagttcacggcaatcaactg
ttgcaggaaacgcaatttacagccgatgaaaatgatgaaaaagtcaagcaacttggcacg
caaaataattttactcaaaccataaaaatgagtgaaatggagcggcacattttcaataaa
gccctgcatatcaaagggaaaaatagtcaatctttattccattttgaccgcctgcaaagc
aaactcaatattcaaaatcgcaatgaattgcaaaataaattgttgaaagactggcaaatt
gaatttttaggattagggcaagacaaacaggttcgcctggacgataaacttgcaggctgc
ctgaaaatcttggaaatggttgaaaaacatctgaatgaaagtgatatgccgtttatcggt
acaaaagaatttacacctaaaaaattatgggaaattttcggcacgccaaaacaaaaatgg
gtcaaaaaagatgatgtaaaaacgactattgccacgcaaaatgattggtatgtgatgaat
aattttgccggaacgggtttggaagaagcgttaattcaatttatttcagcgcgtttgggc
gatttgaaatctcaatatgacgttcatttaatccgtaatgaagaagtgtttaaattgaat
aactttgccgatggcgaaggatttatgccggactttattttattgctgaaagataaacaa
aaatcttcttccaatggtgtgaacgactttttgcattaccaaattttcattgagcccaaa
ggtgagcatttagtggaaactgatggatggaaagaagaatttttagaagccatcactgtg
gaatatgggatggataagatcctgcaaaaagatacaccgcattatcgtttgatcggttta
ccgttttttactgatcatcagaaaaatggacaatttacggagtcattccctttaggtgcg
gcatcgcttgaaaaaatgaagtag

DBGET integrated database retrieval system