KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1471Help
Entry
NMCC_1471         CDS       T00633                                 

Gene name
holC
Definition
(GenBank) DNA polymerase III chi subunit
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00230  Purine metabolism
nmn00240  Pyrimidine metabolism
nmn01100  Metabolic pathways
nmn03030  DNA replication
nmn03430  Mismatch repair
nmn03440  Homologous recombination
Module
nmn_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMCC_1471 (holC)
   00240 Pyrimidine metabolism
    NMCC_1471 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NMCC_1471 (holC)
   03430 Mismatch repair
    NMCC_1471 (holC)
   03440 Homologous recombination
    NMCC_1471 (holC)
Enzymes [BR:nmn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NMCC_1471 (holC)
DNA replication proteins [BR:nmn03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NMCC_1471 (holC)
DNA repair and recombination proteins [BR:nmn03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     NMCC_1471 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ABX73636
UniProt: A9M171
Position
complement(1497412..1497852)
Genome map
AA seq 146 aa AA seqDB search
MPKATFYTHVAQVPIFTCRLIARAIRDGGRILVWSDSFGQLQELDKMLWQYEAESFIPHE
IWETEEAMPSETFVLLACGGNLPRIPEGMAVLNLSDGFWNTAPVLPARVLEIVGNSLEEL
ADARERFTAYRRSGFAIEHHGMEGKA
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgccgaaagccaccttttacacgcacgttgcccaagttccgattttcacctgccgcctg
attgcccgtgcgattcgggacggcggcaggatactggtgtggtccgattcgttcgggcag
cttcaggaattggacaaaatgctttggcaatacgaggccgagagttttattccgcacgaa
atttgggaaacggaagaagccatgccgtctgaaacattcgtcctgcttgcctgcggcggc
aatctgccccgaattcccgaaggcatggccgttttgaacctgtccgacggtttttggaac
accgctccggtcttgcccgcgcgcgttttggaaatcgtcggcaacagcttggaagagctc
gccgacgcgcgcgaacgctttaccgcctaccgccgaagcggttttgccatcgaacatcac
ggcatggagggcaaggcataa

DBGET integrated database retrieval system