KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1530Help
Entry
NMCC_1530         CDS       T00633                                 

Gene name
gpxA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:nmn00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:nmn00480]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1557957..1558556)
Genome map
AA seq 199 aa AA seqDB search
MLLSCRLKHVSDGIGLHQIRIKMGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLT
PQYEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVN
GANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVE
RFAPSVTPEEIEADIRALL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgctgctttcatgccgtctgaagcacgtttcagatggcatcggtttacatcagataagg
ataaaaatgggtatttacgattttcaaatgaaagatgcagaaggcaatgcggttgatttg
tcaggctatcgcggcaaggttctgctgattgtcaacacggcaacgcgttgcggtctgacc
ccgcaatacgaggctttgcagaagctgtatgcacaatataccgcagaaggcttggagatt
ttggattttccgtgcaaccagttccgcgaacaggctcccgaaagcagcggagaaattgcc
caagtgtgtatgatgaagtttggcacgaagtttaagattttcgacaaaatcgaagtcaat
ggagcaaataccgcgcccttgtatgcctacctgaaatccgtcaaaccgcaagataaaggc
aatcatctgtttaaagatttcgtgttgaagctcgcagctttgggagagaagcgcgacgaa
ggcgacatcaaatggaactttaccaaattcctcgtcaaccgcgacggcgaagtggtcgag
cgttttgcgcctagtgttacgcccgaagaaatcgaagccgatattcgggcattgctgtaa

DBGET integrated database retrieval system