KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1530Help
Entry
NMCC_1530         CDS       T00633                                 

Gene name
gpxA
Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    NMCC_1530 (gpxA)
  Metabolism of other amino acids
   00480 Glutathione metabolism
    NMCC_1530 (gpxA)
Enzymes [BR:nmn01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     NMCC_1530 (gpxA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1557957..1558556)
Genome map
AA seq 199 aa AA seqDB search
MLLSCRLKHVSDGIGLHQIRIKMGIYDFQMKDAEGNAVDLSGYRGKVLLIVNTATRCGLT
PQYEALQKLYAQYTAEGLEILDFPCNQFREQAPESSGEIAQVCMMKFGTKFKIFDKIEVN
GANTAPLYAYLKSVKPQDKGNHLFKDFVLKLAALGEKRDEGDIKWNFTKFLVNRDGEVVE
RFAPSVTPEEIEADIRALL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgctgctttcatgccgtctgaagcacgtttcagatggcatcggtttacatcagataagg
ataaaaatgggtatttacgattttcaaatgaaagatgcagaaggcaatgcggttgatttg
tcaggctatcgcggcaaggttctgctgattgtcaacacggcaacgcgttgcggtctgacc
ccgcaatacgaggctttgcagaagctgtatgcacaatataccgcagaaggcttggagatt
ttggattttccgtgcaaccagttccgcgaacaggctcccgaaagcagcggagaaattgcc
caagtgtgtatgatgaagtttggcacgaagtttaagattttcgacaaaatcgaagtcaat
ggagcaaataccgcgcccttgtatgcctacctgaaatccgtcaaaccgcaagataaaggc
aatcatctgtttaaagatttcgtgttgaagctcgcagctttgggagagaagcgcgacgaa
ggcgacatcaaatggaactttaccaaattcctcgtcaaccgcgacggcgaagtggtcgag
cgttttgcgcctagtgttacgcccgaagaaatcgaagccgatattcgggcattgctgtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system