KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1836Help
Entry
NMCC_1836         CDS       T00633                                 

Gene name
folA
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:nmn00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:nmn00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1880728..1881318)
Genome map
AA seq 196 aa AA seqDB search
MQTKNVWRAPVEIFDTECHKMPSEAFRRHFCGGNMLKITLIAACAENLCIGAGNAMPWHI
PEDFAFFKAYTLGKPVIMGRKTWESLPVKPLPGRRNIVISRQADYCAAGAETAASLEAAL
ALCAGAEEAVIMGGAQIYGQAMPLATDLRITEVDLSVEGDAFFPEIDRTHWKEAGRTERR
VSSKGTRYAFVHYLRY
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
gtgcaaacaaaaaacgtatggcgcgcgccggttgagatttttgacacggaatgtcataaa
atgccgtctgaagcgttcagacggcatttttgtggaggaaatatgctcaaaataacccta
attgcggcgtgtgcggaaaacctgtgcatcggggcgggcaatgctatgccttggcacatc
cccgaagatttcgcatttttcaaagcctataccttgggcaaacccgtcattatggggcgg
aaaacgtgggaatccctgcccgtcaaacccctgcccggacggaggaacatcgtcatcagc
cggcaggcggattattgcgcggcaggcgcggaaacggcggcaagtttggaggcggcattg
gcattgtgcgcaggcgcggaagaagctgtcattatgggcggcgcgcagatatacggacaa
gcgatgccattggcgaccgatttgcggataaccgaagtggatttgtctgtggaaggagat
gcatttttccccgaaatagaccggacgcattggaaagaggcagggcggacggaacgccgc
gtcagcagcaaaggcacgcgctatgcttttgtgcattatttgagatattga

DBGET integrated database retrieval system