KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1870Help
Entry
NMCC_1870         CDS       T00633                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00400  Phenylalanine, tyrosine and tryptophan biosynthesis
nmn01100  Metabolic pathways
nmn01110  Biosynthesis of secondary metabolites
nmn01130  Biosynthesis of antibiotics
nmn01230  Biosynthesis of amino acids
Module
nmn_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMCC_1870 (trpC)
Enzymes [BR:nmn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     NMCC_1870 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PIG-X
Motif
Other DBs
NCBI-ProteinID: ABX74001
UniProt: A9M339
Position
1921226..1922050
Genome map
AA seq 274 aa AA seqDB search
MLIFPLSQTNTEHDMTDILNKILATKAQEVAAQKAAVNAEHIRALAAEAAPVRSFIDLIR
GKHRLNLPAVIAEIKKASPSKGLIRPDFRPAEIARAYENAGAACLSVLTDEPYFQGSPEY
LKQAREAVSLPVLRKDFIIDEYQVYQARAWGADAVLLIAAALEQEQLERFEAVAHELGMT
VLLELHDETELEKCRNLTTPLWGVNNRNLRTFEVSLDQTLSLLPALEGKTVVTESGITGK
ADVEFMRTRGVHTFLIGETFMRAADIEAEVGKLF
NT seq 825 nt NT seq  +upstreamnt  +downstreamnt
atgctaatattccccctttcccagacgaatacggaacacgacatgaccgacatcctcaat
aaaatccttgccaccaaagcacaggaagttgccgcccaaaaagccgccgtcaacgccgaa
cacatccgcgcacttgccgcagaagccgcgcccgtccgcagcttcatcgatttgatacgc
ggcaaacaccgcctaaacctgcccgccgtcattgccgaaatcaaaaaggcaagcccgagc
aaaggcctgatccgtccggacttccgaccggccgagattgcacgcgcatatgaaaacgcc
ggagcggcatgtttgtccgtactgaccgacgaaccctatttccaaggttcgcccgaatac
ctcaaacaggcgcgcgaagccgtatcgctgcccgtgctgcgcaaagacttcatcatcgac
gaatatcaggtttatcaggcgcgcgcatggggggcggatgccgtcctgctgattgccgca
gcactggaacaggaacaattggaacgctttgaagcggtggcgcacgaattgggcatgacc
gtcctgctcgagctgcacgatgaaaccgaattggaaaaatgccgcaacctgaccacgccg
ttgtggggcgtaaacaaccgcaacctgaggacttttgaagtctccctcgaccaaaccctg
tcgctgctgcccgcgctggaaggcaaaaccgtcgttaccgaaagcggcattacgggtaag
gcggatgtggaatttatgcggacgcgcggtgtgcacaccttcctgatcggcgaaacgttc
atgcgtgccgccgatattgaggcggaagtgggcaaactcttctaa

DBGET integrated database retrieval system