KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1880Help
Entry
NMCC_1880         CDS       T00633                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nmn03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1929868..1930452
Genome map
AA seq 194 aa AA seqDB search
MISRLTGKLVEKNPPQIVIDVNGVGYEADVSMQTFYNLPPVGESVQLFTQLIIREDAHLL
FGFATAEERKTFRQLIKVGGIGAKTALGILSAMTADELAQAVAEEDVKRLSSAPGIGKKT
AERMVLELRGKLVAHTVTDGLFAAAPAADETEDIVSTLLALGYSEREAKAAVKGVPEGTD
VGEGVRLALKNLLK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagactgaccggcaaactggttgaaaaaaaccctccgcaaatcgtcatcgat
gtcaacggtgtcggctatgaggccgacgtatcgatgcagaccttctacaacctgccgccc
gtgggtgaaagcgtacaactgtttacccagcttatcattcgggaagacgcacatctttta
tttggttttgccactgcggaagaacgcaaaacattccgccaactgatcaaggtcggcggc
atcggcgcgaaaacggctttgggcattttgtcggcgatgacggcagacgagctggcgcag
gcggttgcagaagaagacgtgaaacgcctgtcttccgcgccgggaatcggcaaaaaaacc
gccgaacgtatggtcttggaactgcgcggcaagctggtcgcgcatacggtaacggacggg
ctgtttgccgccgcacccgccgccgacgaaacggaagacatcgtcagcacgctgcttgcg
ctgggttacagcgaacgcgaagcaaaagcggcggtcaaaggcgttccggaggggacggac
gtgggcgaaggcgtgcgccttgctttgaaaaacctgctgaaataa

DBGET integrated database retrieval system