KEGG   Neisseria meningitidis 053442 (serogroup C): NMCC_1968Help
Entry
NMCC_1968         CDS       T00633                                 

Gene name
dxr
Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
nmn  Neisseria meningitidis 053442 (serogroup C)
Pathway
nmn00900  Terpenoid backbone biosynthesis
nmn01100  Metabolic pathways
nmn01110  Biosynthesis of secondary metabolites
nmn01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:nmn00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    NMCC_1968 (dxr)
Enzymes [BR:nmn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     NMCC_1968 (dxr)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXP_reductoisom DXPR_C DXP_redisom_C Mur_ligase
Motif
Other DBs
NCBI-ProteinID: ABX74092
UniProt: A9M3S4
Position
2018477..2019712
Genome map
AA seq 411 aa AA seqDB search
MPSENASDGIRYKVIPIMTPQVLTILGSTGSIGESTLDVVSLHPEKFRVFALAGHKQVEK
LAVQCRTFRPEYAVVADAEHAARLEALLKGDGTATQVLHGAQALVDVASADEVSGVMCAI
VGAVGLPSALAAAQKGKTIYLANKETLVVSGALFMETARANGAAVLPVDSEHNAVFQVLP
RDYAGRLNEHGIASIILTASGGPFLTADLNTFDSITPDQAVKHPNWRMGRKISVDSATMM
NKGLELIEAHWLFNCPPDKLEVVIHPQSVIHSMVRYRDGSVLAQLGNPDMRTPIAYCLGL
PERIDSGVGDLDFDALSALTFQKPDFDRFPCLKLAYEAMNAGGAAPCVLNAANEAAVAAF
LDGQIKFTDIAKTVAHCLAQDFSDGIGDIGGLLAQDARTRAQARAFIGTLR
NT seq 1236 nt NT seq  +upstreamnt  +downstreamnt
atgccgtctgaaaacgcttcagacggcatccggtataaagttatccccattatgacacca
caagtcctgaccatattaggcagtaccggcagcataggcgaaagcacgctggacgttgtc
tccctccaccccgaaaaattccgcgtattcgcgctggcagggcataagcaggtcgagaaa
ctggcggtgcaatgccggacgttccgccccgaatatgccgtcgttgccgatgccgaacac
gccgcccggcttgaagctttgttgaaaggcgacggcacggcgacgcaggttttacacggc
gcgcaggcattggttgacgttgcctctgccgacgaagtcagcggtgtcatgtgcgccatc
gtcggggcggtggggctgccttccgcgctcgcagcggcgcaaaaaggcaaaaccatttat
ctggcgaacaaagagacgctggtggtttccggcgcgttgtttatggaaaccgcccgtgca
aacggcgcggcagtgctgcccgtcgacagcgaacacaacgccgttttccaagttttgccg
cgcgattacgccggccgtctgaacgaacacggcatcgcttcgattatcctgaccgcttcc
ggcggcccgtttctgaccgccgatttaaacacgttcgacagcattacgcccgaccaagcg
gtcaaacaccccaattggcgtatgggacgcaaaatctccgtcgattccgccaccatgatg
aacaaaggtttggagctgattgaagcgcattggctgttcaactgtccgcccgacaaactc
gaagtcgtcatccatccgcaatccgtgatacacagcatggtgcgctaccgcgacggctcc
gtgttggcgcaactgggcaatcccgatatgcgaacgcccatcgcttattgtttgggtttg
cccgagcgcatcgattcgggtgtcggcgacctggatttcgacgcattgtccgcgctgacc
ttccaaaagcccgactttgaccgcttcccctgcctgaagctcgcctatgaagccatgaac
gcaggcggagccgcgccctgcgtattgaacgccgccaacgaagccgccgtcgccgccttt
ttggacgggcagattaagtttaccgacattgccaaaaccgtcgcccattgtctcgcacaa
gacttttcagacggcataggcgacataggggggctcttggcgcaagatgcccggacacgc
gcacaagcgcgggcatttatcggcacactgcgctga

DBGET integrated database retrieval system