KEGG   Natronomonas moolapensis: Nmlp_2305Help
Entry
Nmlp_2305         CDS       T02478                                 

Gene name
elp3
Definition
homolog to elongator complex protein ELP3
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
nmo  Natronomonas moolapensis
Brite
Enzymes [BR:nmo01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Nmlp_2305 (elp3)
Transfer RNA biogenesis [BR:nmo03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Nmlp_2305 (elp3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1245975..1247660)
Genome map
AA seq 561 aa AA seqDB search
MSTDADPAESEAFERVCESLVESLLAGEIDRDDLERAKMDACREHSAPKVPKNTELLEYA
PERHREELEPVLQRKPVRTASGVSPVAIMTSPHTCPHGQCLYCPGGPASEFSSSQSYTGH
EPAAARGVQNDYDPYGQVTLRLHQLRKIGHPVDKVELILMGGTMTARSHDYQEWFLKRAL
EAMNDYDLDAAPEPSETESFKPDPDATEFRYLEDVIAENETNAIRNIGTTFETKPDWCDP
EQIDRMLRLGGTKVEVGVQTTYERINREMHRGHGVQASIDANRRLRNAGFKVGFHMMPGQ
PGMSKEMCLQDFRELFESVDWRPDYLKIYPTLVVRDTVTYDMWRQGEYDPLTNEEAADLV
AEIKSMIPRYTRLQRVQRDIPADFIDAGVWKSNLRQLARQRMDEHGWTCECIRCREVGMN
DADPDGTELDVHTYEAAGGTEHFISIEDFENDLLVGFCRLRFPGDPADGIPAESLRPELE
DAAVVRELHVYGSEVAVGDAGGEDHQHQGYGRRLLASAERLAAEAGFEKLSVISGIGARE
YYREKLGYYQDGPYVSTRLDR
NT seq 1686 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccgacgccgaccccgccgaatccgaggccttcgagcgcgtctgtgagtcgctc
gtcgagtccctgctggcgggcgagatcgaccgcgacgacctcgaacgcgcgaagatggac
gcctgccgggagcactccgcgccgaaggtaccgaaaaacacggagctgctcgagtatgcc
cccgagagacaccgcgaggagctcgagccggtgcttcagcggaagccggtacggacggcc
tcgggcgtctcgccggtcgcgatcatgacgtcgccgcacacctgtccgcacggccagtgt
ctctactgtccgggcggcccggcctcggagttctcctcctcgcagagctacacgggccac
gaaccggccgccgcccgcggcgtccaaaacgactacgacccctacgggcaggtgacgctg
cggctccatcaactccggaagatcggtcatccggtcgacaaggtcgagttgatcctgatg
ggcgggacgatgactgcccgcagccacgactatcaggagtggttcctcaagcgcgccctc
gaggcgatgaacgactacgacctcgatgcggccccggagccgagtgagaccgagtcgttc
aaacccgatcccgacgcgaccgagttccgctatctcgaggacgtgatcgccgagaacgaa
acgaacgcgatccgcaacatcgggacgacgttcgagaccaaacccgactggtgtgatccc
gagcagatcgaccgaatgctgcggctgggcgggacgaaagtcgaagtgggcgtccagacc
acctacgagcggatcaaccgagagatgcaccgcggccacggcgtgcaggcttcgatcgac
gcgaaccgacgcctccggaacgccggtttcaaagtcggcttccacatgatgcccggccag
cccgggatgtccaaggagatgtgcctgcaggacttccgggagctgttcgagagtgtcgac
tggcgccctgactacctgaagatctacccgacgctggtcgtccgcgacaccgtcacctac
gacatgtggcgccagggcgagtacgacccgctcaccaacgaggaagccgccgacctcgtc
gccgaaatcaagtcgatgatcccccgctacacccgcctccaacgcgtccagcgggacatc
ccggcggacttcatcgacgccggcgtctggaagtcgaacctccgccagctggcgagacag
cggatggacgaacacggctggacctgcgagtgtatccggtgtcgcgaggtcggaatgaac
gacgccgaccccgacgggaccgaactagacgtccacacctacgaggccgccggtgggacg
gaacacttcatttcgatcgaggacttcgagaacgacctcctggtcggcttctgtcggctc
cggttccccggcgatcccgccgacgggattcccgccgagtccctccgcccggagctcgaa
gacgccgccgtggtccgggagctgcacgtctacgggagcgaggtcgccgtcggcgacgct
ggcggcgaggaccaccaacaccagggatacggccgacggctcctcgcgtcggccgagcgg
ctggctgccgaggccggcttcgagaagctctctgtcatctcgggcatcggcgcccgggag
tactaccgggagaagctcggctactaccaggacggcccgtacgtctcgacgcggctcgat
cggtga

DBGET integrated database retrieval system