KEGG   Natronomonas moolapensis: Nmlp_2337Help
Entry
Nmlp_2337         CDS       T02478                                 

Definition
(GenBank) peptidase M42 family protein
Organism
nmo  Natronomonas moolapensis
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1280273..1281334)
Genome map
AA seq 353 aa AA seqDB search
MSTDFAFDDELLADLVETPGVPGYEDKIRARVRAELDGHVDRLRSDSMGNLLGTIEGSDP
AYEVVVATHIDEIGFMVKHVDDDGFLELDALGGWDPRILRAQRVTVHTETGDCPGVIGAV
PPHTLTDEQKKAERAVGDARVDLGLDAETVAERVSVGDLVTMDGRTERVGEFVTGKSLDN
RVSVLAAIEAARRIDDPDATIHFAATTQEEVGLRGASALGVDLDPDLVYNLDTTVANDVP
GFEAGEQVTRLGEGAAIKLKDSSVVTNHKLNRRLRGVAEDRGINHQLEVLPAGGTDTGGL
QRAGGARPAGAISIPTRYLHTPTESVHGGDLDAAIELLVAALRTEDGTHDYTL
NT seq 1062 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaccgacttcgcgttcgacgacgaactgctcgcggaccttgtcgagacgcccggc
gtgccgggctacgaggacaaaattcgagcacgggtccgcgcggaactcgacggtcacgtc
gaccggctccggtcggattcgatgggtaacctcctcggcactatcgagggctccgacccc
gcctacgaggtcgtcgtagcgacccacatcgacgagatcgggttcatggtgaaacacgtc
gacgacgatggctttctcgaactcgacgccctcggcggatgggacccgcgtatcctccgg
gcgcagcgagtcacggtccacacggagaccggcgattgtccgggtgtgatcggcgcggtc
ccgccgcacacgctgaccgacgaacaaaagaaagccgaacgggcggtcggcgacgcccgg
gtcgatctcggtctcgacgccgagacggtcgcggagcgggtctccgttggcgacctcgtc
acgatggacggccggaccgaacgcgtcggcgagttcgtcaccggcaagtccctggataac
cgggtgtcggtgctcgcggcgatcgaggcggcccgccggatcgacgaccccgacgcgacg
atccacttcgccgcgacgacccaagaggaggtcggcctccggggggcctcggcgctcggc
gtcgatctcgacccggacctcgtctacaacctggatacgacggtcgcaaacgacgtcccc
ggtttcgaggccggcgagcaggtgacccgactcggcgagggggcggcgatcaaactgaaa
gactcgagtgtcgtcacgaaccacaagctcaaccgacggctccgaggggtggccgaggat
cgcgggatcaaccaccaactcgaggtgttgcctgccggcgggaccgacacgggcggcctc
cagcgcgccggcggtgcccgtcccgcgggcgcgatttcgatcccgacgcggtacctgcac
acgccgactgaaagcgtccacggcggcgacctcgacgcggcgatcgagttgctcgtcgca
gcgttgcggacggaggacgggacgcacgactacacgctctga

DBGET integrated database retrieval system