KEGG   Natronomonas moolapensis: Nmlp_2867Help
Entry
Nmlp_2867         CDS       T02478                                 

Gene name
ligB
Definition
DNA ligase (ATP) (EC:6.5.1.1)
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
nmo  Natronomonas moolapensis
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:nmo00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Nmlp_2867 (ligB)
   03410 Base excision repair
    Nmlp_2867 (ligB)
   03420 Nucleotide excision repair
    Nmlp_2867 (ligB)
   03430 Mismatch repair
    Nmlp_2867 (ligB)
Enzymes [BR:nmo01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Nmlp_2867 (ligB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1832162..1833820
Genome map
AA seq 552 aa AA seqDB search
MEFAEFATRAAAVESVSADTDTVGFVAELFADAGEDLAVVTRFVRGRVFPAHEPTTLDIG
PALCYEALARAARPNVAAADVEAKLAEIGEIGAVAEELDLGGQRGLASFGDGDDGLTVAG
VDAELRALAGAEGVGSTDTKVETLFGLFNRAGPTEARFLARLVLGNMRIGVGEGAVRDAT
AAAFDVPSEAVERAMQVSNDAGLVAETARSEGEPGLGDVRLAVGRPVEAMLAQAGSAVDA
IEAWGSVAVEPKFDGARVQLHYDGVETRLFSRNLEEVTDALPEVVETVAAALDRPAILDG
EVVAVDEDGSPRPFQDVLRRFRRKHDVAAAREAVPVEFYAFDCLHADGDDLLDAPLLERR
ERLSALLGGDDADPGGVADVRIAESVEEIAAREEAALAAGHEGIMLKNPESAYTPGDRGR
NWLKRKPDVETLDLVVTGAEWGEGRRANHFGTFLLSIRDGEAFEPIGKVATGITDEELER
LHERLVSHVRSESGTDVEIDPAVVFEVGYEEIQRSPTYGSGYALRFPRFVAVREDKSPED
ADSLERVERLAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgccgagttcgccacccgtgcggcggcggtcgagtcggtatcagcggacacc
gacaccgtcgggttcgtcgccgagctgttcgccgacgccggcgaggacctcgccgtcgtg
acgcggttcgtccggggacgggtgtttccggcccacgagccgacgaccctcgacatcggg
ccggcgctctgttatgaggcgctcgcgagggcagcacgcccgaacgtcgccgccgccgac
gtcgaagccaagttggccgagatcggcgagatcggcgcggtcgcagaggagttggatctg
ggcggccagcggggactggcgtcgttcggggacggcgacgacggcctcaccgtcgccggc
gtcgacgccgagctccgggcgctcgccggcgccgagggcgtcgggagcaccgacacgaag
gtcgaaacgctgttcgggctgttcaatcgcgccgggccgaccgaggcgcgatttctcgcc
cgcctcgtgttggggaatatgcggatcggcgtcggcgagggagcggtccgggacgcgacc
gcagccgccttcgatgtcccgtcggaggcggtcgagcgtgcgatgcaggtctccaacgac
gccggactcgtcgccgagacagcccgatccgagggcgaacccggactcggggacgtccgc
ctggccgtcggccggccggtcgaggcgatgttggcacaggccgggagcgccgtcgacgcg
atcgaggcgtgggggagcgtcgcggtcgaaccgaagttcgacggagcgcgggtgcaactc
cactacgacggcgtggagacgcggctgttctccagaaacctcgaggaggtaaccgacgcg
ctgcccgaggtcgtcgagaccgtcgctgcggcgctcgatcggccggcgatcctcgacggc
gaggtcgtcgccgtcgacgaggacggctccccgcggccgttccaggacgtgcttcgtcgg
ttccggcggaaacacgacgtcgcggccgccagggaggcggttccggtggagttctacgcc
ttcgactgtctgcacgcggacggcgacgacctcctcgatgcgccgctcctcgaacgacgt
gagcggctgtcggcgcttctggggggggacgacgccgaccccggcggcgtcgccgacgtc
cggatcgccgaatccgtcgaggagatcgcggcccgcgaggaggctgcgctcgcggccggc
cacgaggggatcatgctgaagaaccccgagtcggcgtacacgcccggcgacagggggcga
aactggctgaagcgaaagcccgacgtggagacgctcgatctggtcgtgacgggggccgag
tggggggaggggcggcgggcgaaccacttcgggacgttcctgctctcgatccgcgacggc
gaggcgttcgagcccatcggcaaggtggcgaccgggatcacagacgaggaactcgaacgc
ctccacgagcggctcgtctcccacgtccggtcggagtcgggcaccgacgtcgaaatcgat
cccgcggtcgtcttcgaggtcggctacgaggagatccagcgctcgccgacgtacgggtcc
gggtacgcgcttcggttcccgcggttcgtcgccgtccgcgaggacaaatccccggaggac
gccgacagcctcgaacgggtcgagcggctcgctcggtga

DBGET integrated database retrieval system