KEGG   Natronomonas moolapensis: Nmlp_2867Help
Entry
Nmlp_2867         CDS       T02478                                 

Gene name
ligB
Definition
DNA ligase (ATP) (EC:6.5.1.1)
Orthology
K10747  
DNA ligase 1 [EC:6.5.1.1]
Organism
nmo  Natronomonas moolapensis
Pathway
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Class
Genetic Information Processing; Replication and repair; DNA replication [PATH:nmo03030]
Genetic Information Processing; Replication and repair; Base excision repair [PATH:nmo03410]
Genetic Information Processing; Replication and repair; Nucleotide excision repair [PATH:nmo03420]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:nmo03430]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1832162..1833820
Genome map
AA seq 552 aa AA seqDB search
MEFAEFATRAAAVESVSADTDTVGFVAELFADAGEDLAVVTRFVRGRVFPAHEPTTLDIG
PALCYEALARAARPNVAAADVEAKLAEIGEIGAVAEELDLGGQRGLASFGDGDDGLTVAG
VDAELRALAGAEGVGSTDTKVETLFGLFNRAGPTEARFLARLVLGNMRIGVGEGAVRDAT
AAAFDVPSEAVERAMQVSNDAGLVAETARSEGEPGLGDVRLAVGRPVEAMLAQAGSAVDA
IEAWGSVAVEPKFDGARVQLHYDGVETRLFSRNLEEVTDALPEVVETVAAALDRPAILDG
EVVAVDEDGSPRPFQDVLRRFRRKHDVAAAREAVPVEFYAFDCLHADGDDLLDAPLLERR
ERLSALLGGDDADPGGVADVRIAESVEEIAAREEAALAAGHEGIMLKNPESAYTPGDRGR
NWLKRKPDVETLDLVVTGAEWGEGRRANHFGTFLLSIRDGEAFEPIGKVATGITDEELER
LHERLVSHVRSESGTDVEIDPAVVFEVGYEEIQRSPTYGSGYALRFPRFVAVREDKSPED
ADSLERVERLAR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggagtttgccgagttcgccacccgtgcggcggcggtcgagtcggtatcagcggacacc
gacaccgtcgggttcgtcgccgagctgttcgccgacgccggcgaggacctcgccgtcgtg
acgcggttcgtccggggacgggtgtttccggcccacgagccgacgaccctcgacatcggg
ccggcgctctgttatgaggcgctcgcgagggcagcacgcccgaacgtcgccgccgccgac
gtcgaagccaagttggccgagatcggcgagatcggcgcggtcgcagaggagttggatctg
ggcggccagcggggactggcgtcgttcggggacggcgacgacggcctcaccgtcgccggc
gtcgacgccgagctccgggcgctcgccggcgccgagggcgtcgggagcaccgacacgaag
gtcgaaacgctgttcgggctgttcaatcgcgccgggccgaccgaggcgcgatttctcgcc
cgcctcgtgttggggaatatgcggatcggcgtcggcgagggagcggtccgggacgcgacc
gcagccgccttcgatgtcccgtcggaggcggtcgagcgtgcgatgcaggtctccaacgac
gccggactcgtcgccgagacagcccgatccgagggcgaacccggactcggggacgtccgc
ctggccgtcggccggccggtcgaggcgatgttggcacaggccgggagcgccgtcgacgcg
atcgaggcgtgggggagcgtcgcggtcgaaccgaagttcgacggagcgcgggtgcaactc
cactacgacggcgtggagacgcggctgttctccagaaacctcgaggaggtaaccgacgcg
ctgcccgaggtcgtcgagaccgtcgctgcggcgctcgatcggccggcgatcctcgacggc
gaggtcgtcgccgtcgacgaggacggctccccgcggccgttccaggacgtgcttcgtcgg
ttccggcggaaacacgacgtcgcggccgccagggaggcggttccggtggagttctacgcc
ttcgactgtctgcacgcggacggcgacgacctcctcgatgcgccgctcctcgaacgacgt
gagcggctgtcggcgcttctggggggggacgacgccgaccccggcggcgtcgccgacgtc
cggatcgccgaatccgtcgaggagatcgcggcccgcgaggaggctgcgctcgcggccggc
cacgaggggatcatgctgaagaaccccgagtcggcgtacacgcccggcgacagggggcga
aactggctgaagcgaaagcccgacgtggagacgctcgatctggtcgtgacgggggccgag
tggggggaggggcggcgggcgaaccacttcgggacgttcctgctctcgatccgcgacggc
gaggcgttcgagcccatcggcaaggtggcgaccgggatcacagacgaggaactcgaacgc
ctccacgagcggctcgtctcccacgtccggtcggagtcgggcaccgacgtcgaaatcgat
cccgcggtcgtcttcgaggtcggctacgaggagatccagcgctcgccgacgtacgggtcc
gggtacgcgcttcggttcccgcggttcgtcgccgtccgcgaggacaaatccccggaggac
gccgacagcctcgaacgggtcgagcggctcgctcggtga

DBGET integrated database retrieval system