KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_0085Help
Entry
NMBB_0085         CDS       T01932                                 

Definition
dTDP-D-glucose 4,6-dehydratase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:nmp00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:nmp00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
87061..87603
Genome map
AA seq 180 aa AA seqDB search
MMNIIDTRIPDVKLLEPKVFGDERGFFMETFRDEWFRQNVAERTFVQENHSKSTQGVLRG
LHYQTENTQGKLVRVVSGEVFDVAVDMRRDSPTFGHWVGEVLSADNKRQLWVPEGFAHGF
YVLSDEAEFVYKCTDYYNPNAEHSLIWNDATVGIDWPLLGEPSLSAKDLAGKMLAEAATF
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atgatgaatatcatcgatacccgcattcccgatgtcaaattgctcgaacccaaagtcttc
ggtgacgagcgtggtttttttatggaaaccttccgtgatgaatggttccgccaaaatgta
gccgagcgcactttcgtgcaggaaaaccacagcaaatccacccaaggcgtattacgcggt
ttacattatcaaaccgaaaatacacaaggcaaactggtgcgcgtggtatcaggcgaagtc
tttgatgttgccgtggatatgcgtcgtgatagtcctactttcggccactgggtcggtgag
gttttatcggcagacaacaaacgccaattatgggtgccggaagggtttgcccatggattt
tatgtgttgagcgatgaagcggaattcgtctacaaatgcaccgactattacaacccgaat
gcggaacattccctaatttggaatgatgccacagtgggaatcgactggcctttattggga
gaaccaagcctatcggccaaggatttggcaggcaagatgcttgctgaagcggccacattt
taa

DBGET integrated database retrieval system