KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_0289Help
Entry
NMBB_0289         CDS       T01932                                 

Definition
Holliday junction DNA helicase
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMBB_0289
Enzymes [BR:nmp01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NMBB_0289
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(269195..269779)
Genome map
AA seq 194 aa AA seqDB search
MISRLTGKLVEKNPPQIVIDVNGVGYEADVSMQTFYNLPPVGESVQLFTQLIIREDAHLL
FGFATAEERKTFRQLIKVGGIGAKTALGILSAMTADELAQAVAEEDVKRLSSAPGIGKKT
AERMVLELRGKLVAHTVTDGLFAAAPAADETEDIVSTLLALGYSEREAKAAVKGVPEGTD
VGEGVRLALKNLLK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgatcagcagactgaccggcaaactggttgaaaaaaaccctccgcaaatcgtcatcgat
gtcaacggtgtcggctatgaggccgacgtatcgatgcagaccttctacaacctgccgccc
gtgggtgaaagcgtacaactgtttacccagcttatcattcgggaagacgcacatctttta
tttggttttgccactgcggaagaacgcaaaacattccgccaactgatcaaggtcggcggc
atcggcgcgaaaacggctttgggcattttgtcggcgatgacggcagacgagctggcgcag
gcggttgcagaagaagacgtgaaacgcctgtcttccgcgccgggaatcggcaaaaaaacc
gccgaacgtatggtcttggaactgcgcggcaagctggtcgcgcatacggtaacggacggg
ctgtttgccgccgcacccgccgccgacgaaacggaagacatcgtcagcacgctgcttgcg
ctgggttacagcgaacgcgaagcaaaagcggcggtcaaaggcgttccggaggggacggac
gtgggcgaaggcgtgcgccttgctttgaaaaacctgctgaaataa

DBGET integrated database retrieval system