KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_0300Help
Entry
NMBB_0300         CDS       T01932                                 

Definition
indole-3-glycerol phosphate synthase (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:nmp01230]
Metabolism; Amino acid metabolism; Phenylalanine, tyrosine and tryptophan biosynthesis [PATH:nmp00400]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(277597..278379)
Genome map
AA seq 260 aa AA seqDB search
MTDILNKILATKAQEVAAQKAAVNAEHIRALAAEAVPVRSFIDSIRGKHRLNLPAVIAEI
KKASPSKGLIRPDFRPAEIARAYENAGAACLSVLTDEPYFQGSPEYLKQAREAVSLPVLR
KDFIIDEYQVYQARAWGADAVLLIAAALEQEQLERFEAVAHELGMTVLLELHDETELEKC
RNLTTPLWGVNNRNLRTFEVSLDQTLSLLHALEGKTVVTESGITGKADVEFMQSRGVHTF
LIGETFMRADDIEAEVGKLF
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcctcaataaaatccttgccaccaaagcacaggaagttgccgctcaaaaa
gccgccgtcaacgccgaacacatccgcgcacttgccgcagaagccgtgcccgtccgcagc
ttcatcgattcgatacgcggcaaacaccgcctaaacctgcccgctgtcattgccgaaatc
aaaaaggcaagcccgagcaaaggcctgatccgtccggacttccgaccggccgagattgca
cgcgcctatgaaaacgccggagcggcgtgtttgtccgtactgaccgacgaaccctatttc
caaggttcgcccgaatacctcaaacaggcgcgcgaagccgtatcgctgcccgtgctgcgc
aaagacttcatcatcgatgaatatcaggtttatcaggcgcgcgcatggggggcggatgcc
gtcctgctgattgccgccgcactggaacaggaacaattggaacgctttgaagcggtggcg
cacgaattgggcatgaccgtcctgctcgagctgcacgacgaaaccgaattggaaaaatgc
cgcaacctgaccacgccgctgtggggcgtaaacaaccgcaacctgaggacttttgaagtc
tccctcgaccaaaccctgtcgctgctgcacgcgctggaaggcaaaaccgtcgttaccgaa
agcggcattacgggtaaggcggatgtggaatttatgcaatcgcgcggcgtgcacaccttc
ctgattggcgaaacgttcatgcgtgccgacgatattgaggcggaagtgggcaaactcttc
taa

DBGET integrated database retrieval system