KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_0456Help
Entry
NMBB_0456         CDS       T01932                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NMBB_0456
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    NMBB_0456
Enzymes [BR:nmp01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     NMBB_0456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
421810..423288
Genome map
AA seq 492 aa AA seqDB search
MFSKLTPLAETGIPTLSCANAAGRLLHSDSRQIKQGDIFVACPGEYADGRSYIPAAVANG
AAFVFWDDDGKFAWNPEWKVPNQGIKDLKHRAGILAAQVYGNVSDGLKVWGVTGTNGKTS
ITQWLAQAADLLGEKTAIVGTVGNGFWGALEETTHTTPAPVDVQTLLYRFRQQGATVAAM
EVSSHGLDQSRVNGVSFRSAIFTNLTRDHLDYHGTMEAYGAIKSRLFYWHGLKHAVINVD
DEYGAELAGRLKKDCPDLAVYSYGFSEHADIRITDFTASSDGIAAVFQTLWGEGKCRTRL
LGRFNAQNLAACIALLCANGYPLDNVLDVLAKIRPASGRMDCIMNSGKPLVVVDYAHTPD
ALEKALATLQEIKPQGAALWCVFGCGGNRDRGKRPLMGAAAVQGADKVVVTSDNPRLENP
HDIINDILPAVPAPECVEADRAAAIRYAVEQAAANDIILIAGKGHENYQDVQGVKHRFSD
LEIVGQALLTRK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgttcagcaagttaacccctttggctgaaaccggcatcccgaccctgtcgtgtgcaaac
gcggcagggcgtttgttgcattcagacagccgccaaatcaaacaaggcgatattttcgtt
gcctgtccgggcgaatatgccgacggacgcagttatatccccgccgccgttgccaacggc
gcggcttttgttttttgggacgacgatggcaaattcgcgtggaatcccgaatggaaagtc
cccaatcaaggcatcaaagatttgaaacaccgtgccggcatattggcggcgcaagtttac
ggcaacgtttcagacggtctcaaagtctggggcgtaaccggaaccaacggcaaaacctcc
atcacgcaatggctggcgcaagctgccgatttgttgggcgaaaaaaccgccattgtcggc
acggtcggcaacggcttttggggtgcattggaagaaaccacgcataccacacccgccccc
gtcgatgtccaaaccctgctctaccgtttccgtcaacaaggcgcaacagtcgccgcgatg
gaagtctccagccacgggcttgaccagtcgcgcgtcaacggcgtgtcattccgcagcgca
atctttaccaacctcacccgcgaccacctcgactaccacggcacgatggaagcctacggt
gccatcaagtcgcgcctgttttactggcacggcttgaaacacgccgttatcaatgtagat
gacgaatacggcgcggaactcgcaggtcgtctgaaaaaagattgtcccgatttggccgtt
tatagctacggcttcagcgaacacgccgacatccgcattaccgactttaccgcctcttca
gacggcatagcagccgtattccaaaccctgtggggcgaagggaaatgccgcacgcgcctg
ctcggacggttcaacgcgcaaaacctcgccgcctgcatcgccttgctgtgcgccaacggc
tatccgcttgataatgtattggatgtgctggcaaaaatccgtcccgcttcagggcgcatg
gactgcatcatgaacagcggcaaacctttggtcgttgtcgattatgcccatacgcccgac
gcattggaaaaagcactcgccaccttgcaggaaatcaaaccgcagggtgcggctttgtgg
tgcgtattcggttgcggcggcaaccgcgatcgcggcaaacgcccgctgatgggcgcggca
gccgtacagggcgcggataaagtcgtcgtcaccagcgacaatccgcgtttggaaaatccg
cacgacatcatcaacgacatcctgcctgccgttcccgcgcccgaatgcgtcgaagccgac
cgtgccgccgccatccgttatgcggttgaacaagccgccgcaaacgacatcatcctgatt
gccggcaaagggcatgaaaactatcaggatgtacaaggcgtgaagcaccgtttttccgat
cttgaaatcgtcggacaggctttgttaactcgtaaataa

DBGET integrated database retrieval system