KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_0595Help
Entry
NMBB_0595         CDS       T01932                                 

Gene name
adhA
Definition
(GenBank) alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
nmp00010  Glycolysis / Gluconeogenesis
nmp00071  Fatty acid degradation
nmp00350  Tyrosine metabolism
nmp00625  Chloroalkane and chloroalkene degradation
nmp00626  Naphthalene degradation
nmp01100  Metabolic pathways
nmp01110  Biosynthesis of secondary metabolites
nmp01120  Microbial metabolism in diverse environments
nmp01130  Biosynthesis of antibiotics
nmp01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBB_0595 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    NMBB_0595 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMBB_0595 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMBB_0595 (adhA)
   00626 Naphthalene degradation
    NMBB_0595 (adhA)
Enzymes [BR:nmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMBB_0595 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N ADH_zinc_N_2 CoA_binding Methyltransf_25 TrkA_N DUF2237 Methyltransf_31 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: ADO31051
UniProt: E3D230
Position
complement(568485..569531)
Genome map
AA seq 348 aa AA seqDB search
MKMQAVVVNKNVAGDVEVIEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVL
GHEGIGLVKEVADGVQNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGG
MATHCIVSADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSSVRPGQWIAIYGAGGLGNL
GVQYAKKVFGAHVVAIDINDDKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHVAIVTA
VSAAAFNSAVDCVRAGGRVVAIGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQF
GAEGLVVPKVELRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaagtaatcgaa
cgcgaggttcgcccgttggaatacggcgaggcattggtcgaagtcgaatattgcggcgtg
tgccacaccgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgttg
ggacacgaaggcatcggtttggttaaagaagttgccgacggtgtgcaaaatctgaaagtc
ggcgaccgcgtcagcatcgcctggctgttccaaagctgcggctcgtgcgaatactgcaat
accggccgcgaaaccctgtgccgctctgtattgaacgctggctatactgccgacggcggc
atggcgacccactgtatcgtgagtgccgattacgcggtcaaagtccctgaaggtttggat
cctgcgcaagcttcgagcattacttgtgccggcgtgaccacttataaagccattaaagtt
tccagtgttcgtccgggacagtggattgccatctacggcgcgggcggtttgggcaacttg
ggggtccaatacgcgaaaaaagtattcggcgcgcacgttgtcgccatcgacatcaacgac
gacaaactggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaa
gacgctgccaaagtgattcaggaaaaaaccggcggtgcacacgtagccattgttaccgcc
gtatccgccgccgcattcaactccgctgtggactgcgtccgcgcaggcggtcgcgtcgtc
gccattggcctgccgcccgaatctatggacctgtccattcctcgtctggtcttggacggc
atcgaagtggtcggctctttggtcggtacccgcaaagatttggaagaagcattccaattc
ggcgcagaaggcttggttgtgcctaaagtcgagttgcgtgctttggatgaagcgcctgcc
atcttccaagaaatgcgcgaaggtaaaattaccggccgtatggtaatcgatatgaaaaaa
gaatgcggctgcggccatcaccactga

DBGET integrated database retrieval system