KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_0595Help
Entry
NMBB_0595         CDS       T01932                                 

Gene name
adhA
Definition
alcohol dehydrogenase (EC:1.1.1.1)
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    NMBB_0595 (adhA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBB_0595 (adhA)
  Lipid metabolism
   00071 Fatty acid degradation
    NMBB_0595 (adhA)
  Amino acid metabolism
   00350 Tyrosine metabolism
    NMBB_0595 (adhA)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NMBB_0595 (adhA)
   00626 Naphthalene degradation
    NMBB_0595 (adhA)
Enzymes [BR:nmp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NMBB_0595 (adhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(568485..569531)
Genome map
AA seq 348 aa AA seqDB search
MKMQAVVVNKNVAGDVEVIEREVRPLEYGEALVEVEYCGVCHTDLHVAAGDYGEKPGRVL
GHEGIGLVKEVADGVQNLKVGDRVSIAWLFQSCGSCEYCNTGRETLCRSVLNAGYTADGG
MATHCIVSADYAVKVPEGLDPAQASSITCAGVTTYKAIKVSSVRPGQWIAIYGAGGLGNL
GVQYAKKVFGAHVVAIDINDDKLAFAKETGADLVVNAAKEDAAKVIQEKTGGAHVAIVTA
VSAAAFNSAVDCVRAGGRVVAIGLPPESMDLSIPRLVLDGIEVVGSLVGTRKDLEEAFQF
GAEGLVVPKVELRALDEAPAIFQEMREGKITGRMVIDMKKECGCGHHH
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgcaggcagttgttgtgaataaaaatgtagcgggcgatgtggaagtaatcgaa
cgcgaggttcgcccgttggaatacggcgaggcattggtcgaagtcgaatattgcggcgtg
tgccacaccgacctgcacgttgcggcaggcgactacggcgaaaaaccgggccgcgtgttg
ggacacgaaggcatcggtttggttaaagaagttgccgacggtgtgcaaaatctgaaagtc
ggcgaccgcgtcagcatcgcctggctgttccaaagctgcggctcgtgcgaatactgcaat
accggccgcgaaaccctgtgccgctctgtattgaacgctggctatactgccgacggcggc
atggcgacccactgtatcgtgagtgccgattacgcggtcaaagtccctgaaggtttggat
cctgcgcaagcttcgagcattacttgtgccggcgtgaccacttataaagccattaaagtt
tccagtgttcgtccgggacagtggattgccatctacggcgcgggcggtttgggcaacttg
ggggtccaatacgcgaaaaaagtattcggcgcgcacgttgtcgccatcgacatcaacgac
gacaaactggcgtttgccaaagaaaccggcgcggatttggttgtcaacgccgccaaagaa
gacgctgccaaagtgattcaggaaaaaaccggcggtgcacacgtagccattgttaccgcc
gtatccgccgccgcattcaactccgctgtggactgcgtccgcgcaggcggtcgcgtcgtc
gccattggcctgccgcccgaatctatggacctgtccattcctcgtctggtcttggacggc
atcgaagtggtcggctctttggtcggtacccgcaaagatttggaagaagcattccaattc
ggcgcagaaggcttggttgtgcctaaagtcgagttgcgtgctttggatgaagcgcctgcc
atcttccaagaaatgcgcgaaggtaaaattaccggccgtatggtaatcgatatgaaaaaa
gaatgcggctgcggccatcaccactga

DBGET integrated database retrieval system