KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_0600Help
Entry
NMBB_0600         CDS       T01932                                 

Gene name
dsbC
Definition
thiol:disulfide interchange protein DsbC (EC:5.3.4.1)
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Brite
Enzymes [BR:nmp01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NMBB_0600 (dsbC)
Secretion system [BR:nmp02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   NMBB_0600 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(574021..574803)
Genome map
AA seq 260 aa AA seqDB search
MKTKLIKILTPFTVLPLLACGQTPVSNANAEPAVKAESAGKSVAASLKARLEKTYSAQDL
KVLSVSETPVKGIYEVVVSGRQIIYTDAEGGYMFVGELINIDTRKNLTEERAADLNKIDF
ASLPLDKAIKEVRGNGKLKVAVFSDPDCPFCKRLEHEFEKMTDVTVYSFMMPIAGLHPDA
ARKAQILWCQPDRAKAWTDWMRKGKFPVGGSICDNPVAETTSLGEQFGFNGTPTLVFPNG
RSQSGYSPMPQLEEIIRKNQ
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaagttaatcaaaatcttgaccccctttaccgtcctcccactgctggcttgc
gggcaaacgcccgtttccaatgccaacgccgaacccgccgtcaaagccgagtccgccggc
aaatccgttgccgcctctttgaaagcgcgtttggaaaaaacctattccgcccaagatttg
aaagtgttgagcgtcagcgaaacaccggtcaaaggcatttacgaagtcgtcgtcagcggc
aggcagattatctacaccgatgccgaaggcggctatatgttcgtcggcgaactcatcaac
atcgacacgcgcaaaaacctgaccgaagaacgcgccgccgatttgaacaaaatcgacttc
gcctccctgcctttggacaaagccatcaaagaagtgcgcggcaacggcaagctgaaagtc
gccgtcttctccgaccccgattgtccgttctgcaaacgcttggaacacgagtttgaaaaa
atgaccgacgtgacggtttacagctttatgatgcccattgccggcctgcaccccgatgcc
gcgcgcaaggcgcaaatcttatggtgtcagcccgaccgcgccaaagcgtggacggattgg
atgcgtaaaggcaaattcccggtcggcggcagcatctgcgacaatcccgtcgcggaaacc
acttccttgggcgaacaattcggcttcaacggcacgccgaccctcgtcttccccaacggg
cgcagccaaagcggctacagcccgatgccccaactggaggaaatcatccgcaaaaatcaa
taa

DBGET integrated database retrieval system