KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_0785Help
Entry
NMBB_0785         CDS       T01932                                 

Definition
putative tryptophan synthase beta chain (EC:4.2.1.20)
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMBB_0785
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMBB_0785
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NMBB_0785
Enzymes [BR:nmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NMBB_0785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
726329..727531
Genome map
AA seq 400 aa AA seqDB search
MKNYHAPDEKGVFGEHGGLYVSETLIPALQELADAYKAAKNDPSFWEEFHRDLKHYVGRP
SPVYHAARLSEHLGGAQIWLKREDLNHTGAHKVNNTIGQALLAKRMGKKRVIAETGAGQH
GVASATVAARFGMTCDVYMGADDIQRQMPNVFRMKLLGANVVGVDSGSRTLKDAMNEAMR
EWVARVDDTFYIIGTAAGPAPYPEMVRDFQCVIGNEAKEQMLEAIGRQPDVAVACVGGGS
NAIGLFHPYIGEENVRLVGVEAGGLGVNTPDHAAPITSGSPIGVLHGFRSYLMQDENGQV
LGTHSVSAGLDYPGIGPEHSHLHDIKRVEYTVAKDDEALEAFDLLCRFEGIIPALESSHA
VAWAVKNAPKMGKDQVILVNLSGRGDKDINTVAKLKGIKL
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgaagaattaccacgcacccgacgagaagggcgttttcggcgaacacggtgggctttat
gtttccgagaccctgattcccgccttgcaagagctggcggatgcctataaggcagcgaaa
aacgacccgtcgttttgggaagaattccaccgcgatttgaaacactacgtcggcaggccc
agccccgtttaccatgccgcgcgattgtccgagcatttgggtggcgcgcaaatttggttg
aagcgcgaagacttgaaccacaccggcgcgcacaaagtcaacaacaccatcggtcaggca
ctgttggcaaaacgtatgggtaaaaaacgcgtcatcgccgaaaccggcgcgggtcagcac
ggcgtggcgagtgccactgttgccgcccgcttcggcatgacttgcgacgtgtacatgggt
gcggacgacatccaacgccaaatgcccaacgtgttccgtatgaaattattgggcgcgaat
gtcgtcggcgttgacagcggcagccgtactttgaaagacgcgatgaacgaagccatgcgc
gaatgggtcgcccgcgtggatgacacattctacatcatcggtaccgccgccggtcccgcg
ccgtatcccgaaatggtgcgcgactttcaatgcgtgatcggcaatgaagccaaagaacaa
atgttggaagccatcggcagacagcccgacgttgccgttgcctgcgtgggcggcggatcg
aacgccattggtttgttccacccgtatatcggcgaagaaaacgtgcgcctcgtcggcgtg
gaggctggcggtttgggcgtgaacacccccgatcacgccgcgccgattacttcgggctca
ccgattggcgtattgcacggtttccgcagctatctgatgcaggacgaaaacggtcaagtc
ttgggtacacactctgtttccgcaggcttggattaccccggcatcggcccggaacacagc
catctgcacgacatcaagcgcgtcgaatacaccgttgccaaagacgacgaagcactcgaa
gcctttgacttgctctgccgcttcgagggcatcatccccgcgctcgaatccagccacgcc
gttgcttgggcggtgaaaaatgcgccgaaaatgggtaaagaccaagtgattctggtcaac
ctctcaggtcgtggcgacaaagacatcaataccgtcgcgaagctcaaagggattaaactg
taa

DBGET integrated database retrieval system