KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_0894Help
Entry
NMBB_0894         CDS       T01932                                 

Definition
phosphoglucomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBB_0894
   00030 Pentose phosphate pathway
    NMBB_0894
   00051 Fructose and mannose metabolism
    NMBB_0894
   00052 Galactose metabolism
    NMBB_0894
   00500 Starch and sucrose metabolism
    NMBB_0894
   00520 Amino sugar and nucleotide sugar metabolism
    NMBB_0894
  Nucleotide metabolism
   00230 Purine metabolism
    NMBB_0894
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    NMBB_0894
Enzymes [BR:nmp01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     NMBB_0894
    5.4.2.8  phosphomannomutase
     NMBB_0894
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(821426..822808)
Genome map
AA seq 460 aa AA seqDB search
MANIARDIFKAYDIRGIVGKTLTDDAAYLIGRAIAAKAAEKGMTRIALGRDGRLSGPELM
EHIQRGFTDSGIGVLNVGMVATPMLYFAAINECGGSGVMITGSHNPPDYNGFKMMLGGDT
LAGEAIQELLAIVEKDGFVAADKQGNVTEKDISGEYHNHIVGHIKLKRPMKIVIDAGNGV
GGAFAGKLYKGLGNEVTELFCDVDGTFPNHHPDPSKPKNLQDLIAALKNGDAEIGLAFDG
DADRLGVVTKDGNIIYPDRQLMLFAQDVLSRNPKAKVIFDVKSTRLLAPWIKEHGGEPVM
EKTGHSFIKSSMKKTGAPVAGEMSGHIFFKERWFGFDDGLYAGARLLEILSASDNPSEVL
NNLPQSISTPELNIALPEGSNGHQVIDELAAKAEFEGATEIITIDGLRVEFPDGFGLMRA
SNTTPILVLRFEADTQAAIERIQNQFKAVIESNPNLIWPL
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atggcaaatattgcccgcgacatcttcaaagcctacgacatccgaggcattgtcggcaaa
accctgactgacgatgccgcctatctcatcggcagggccatcgccgccaaagccgccgaa
aaaggcatgacccgcatcgcgctcggacgcgacggacgcttgagcggtcccgaactgatg
gagcacatccaacgcggctttaccgacagcggcatcggcgtactcaacgtcggcatggtc
gccactcctatgctctattttgccgccatcaacgaatgcggcggcagcggcgtgatgatt
accggcagccacaatccgcctgattacaacggtttcaaaatgatgctcggcggcgacacg
ctcgcaggcgaagccattcaagaacttttagctattgttgagaaagatggttttgttgcc
gccgacaaacaaggcaacgtaaccgaaaaagacatctccggcgaataccacaaccacatc
gtcggccacatcaaactcaaacgcccgatgaaaatcgtgattgacgcgggcaacggcgtg
ggcggcgcgtttgccggcaaactctataaaggcttgggcaacgaagtaaccgagcttttc
tgcgacgtggacggcactttccccaaccaccatcccgacccatccaaaccgaaaaacctg
caagatttgattgccgcgctgaaaaacggtgatgccgaaatcggcttggcgtttgacggc
gatgccgaccgcttgggtgtggtcaccaaagacggcaacattatttatcccgaccgccaa
ctgatgctgttcgcgcaagacgtgttgagccgcaatcctaaagccaaagtaattttcgac
gtcaaatccacccgtctgcttgcgccttggattaaagaacacggcggcgaacctgtgatg
gaaaaaaccggccacagctttatcaaatcctccatgaaaaaaaccggcgcgccggttgcc
ggcgaaatgagcggacacatcttcttcaaagaacgctggttcggcttcgacgacggtctg
tacgccggcgcacgcctcttggaaatcctgtctgcctccgataatccgtccgaagtgtta
aacaacctgccgcaaagcatttccacgcccgaactcaacatcgccctgcccgaaggcagc
aacggccatcaggttatcgacgaactcgccgccaaagccgaatttgaaggcgcaaccgaa
atcatcaccatcgacggtctgcgcgttgaatttcccgacggcttcggtctgatgcgtgct
tccaataccacgccgattctggtgttgcgttttgaggcggatacgcaagcagccatcgag
cggattcaaaaccaattcaaagccgtcatcgaaagcaatccgaatctaatctggcctctg
taa

DBGET integrated database retrieval system