KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_0906Help
Entry
NMBB_0906         CDS       T01932                                 

Definition
putative delta-aminolevulinic acid dehydratase (EC:4.2.1.24)
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    NMBB_0906
Enzymes [BR:nmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     NMBB_0906
Exosome [BR:nmp04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   NMBB_0906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
830654..831655
Genome map
AA seq 333 aa AA seqDB search
MQFPYRNVPASRMRRMRRDDFSRRLMREHTLTADDLIYPVFVLEGSAREEDVPSMPGVKR
QSLDRLLFTAEEAVKLGIPMLALFPVVTANKTERAQEAYNPEGLVPSTVRALRERFPELG
IMTDVALDPYTVHGQDGLTDENGYVMNDETVEVLVKQALCHAEAGAQVVAPSDMMDGRIG
AIREALEDAGHIHTRIMAYSAKYASAFYGPFRDAVGSSGNLGKADKKTYQMDPANTDEAL
NEVALDIREGADMVMVKPGLPYLDVVRRVKDEFGVPTYAYQVSGEYAMLQAAIANGWLDG
GKVVLESLLAFKRAGADGILTYYAIEAAKMLKR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
atgcagtttccttaccgcaatgttccggcttcgcgtatgcgccgtatgcgcagggacgat
ttttcacgccgcctgatgcgcgaacacacgctgaccgccgatgatttgatttatccggtg
ttcgtattggaggggtcggcgcgcgaggaggatgtgccttctatgccgggtgtgaagcgt
caaagtttggacaggctgctgtttacggcggaagaggcggtaaagctcggtattccgatg
ttggcactgttccccgtggttacggcaaacaaaaccgagcgtgcgcaggaggcgtacaat
cccgaaggactcgtgccgtcaactgtccgcgccttgcgcgagaggtttcccgaactgggc
attatgacggatgtcgcgctcgatccttatacggttcacggtcaggacgggctgacggac
gaaaacggttatgtgatgaacgatgaaaccgtagaggttttggtcaagcaggctttgtgc
cacgctgaagcgggcgcgcaggtggttgccccttccgatatgatggacgggcgtatcggt
gcgattcgcgaggcgttggaggatgccgggcatatccacacgcggattatggcgtattcc
gccaaatatgcttcggcgttttacgggccgttccgcgatgcggtgggcagttcgggcaat
ttgggcaaggcggacaagaaaacctaccagatggatccggcaaataccgatgaggcgctg
aatgaagtggcgctcgatattcgggaaggtgcggatatggtgatggtgaagcccggttta
ccgtatttggacgttgtccgccgcgtgaaggacgagttcggcgtaccgacttatgcctat
caggtttcgggagaatacgcgatgttgcaggcagcgattgccaacggctggctggacggc
ggcaaagtggttttggaaagcctgctggcattcaaacgtgcgggtgcggacgggattttg
acctattacgctattgaggcggcaaagatgttgaagcgttga

  All links  
No link information was found.   
DBGET integrated database retrieval system