KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_1319Help
Entry
NMBB_1319         CDS       T01932                                 

Definition
exodeoxyribonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:nmp03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1156457..1158202)
Genome map
AA seq 581 aa AA seqDB search
MERQTDEFAQAAARAAIWFLARYAGSGSEVLANCTERLFQALQNGHSFIRLSGGEADALS
ALAPVVGTSAAPLILEGRRLFLGRMWQLEYDLAAEIKRLAAAGTSAPDAAGARQNLAKWF
QGTGSEGQRDAAALALLQSFMVITGGPGTGKTTTVAKLLALICGEDENLPNIALAAPTGK
AAAHMARALHRAINGFDAPEAIRRHLLKLEGQTVHRLLKLRPPKMQAAFNPVYPLPFDVL
VIDEASMLDTALMLQLLKAVKTGARVILLGDENQLPSVGIGAVLSVLSQKTVLDGETHQR
LAGFLPEHGFSVSANPPVLAQNTAHLSFSHRFGDNSGIGCLARAAVSGDEGAWALFDRFP
DELEHSECSPNARVERLYRAHKAYWQAVKDGNIEAAYAGISDIVVLAAWRQDAEDFNEAY
CRHVRRKMNIPEHQAYFAGEPIMIRQNDYALELFNGDIGLIMEDVGRQGGLAAYFADADG
FKKVAVSCLPDFEPAFAMTVHKSQGSEYREVWLLPPSAAPSDEGDDALSGLSRGLLYTAI
TRAREKFVFFGGEEAFRQAAVTVKTRQTALGSMLERVFSQE
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggaacggcagacagatgaatttgcccaagcggcggcaagggcggcaatctggtttttg
gcacgctatgcgggttcaggcagcgaagtgcttgcaaactgcaccgaacgcctgtttcag
gcattgcaaaacggtcattcgtttatccgtttgagcggtggcgaggctgacgcgctgtcg
gcactcgcacccgtggtcggaacatccgccgcgcctttgattttggaaggcagaaggctg
tttttgggcaggatgtggcagttggaatacgatttggctgccgagataaaacgcttggcg
gcagccggcacgtccgcccccgacgcggcaggcgcgcggcaaaacctcgcaaaatggttt
caaggcacgggcagcgaagggcagcgcgatgccgccgccttggcactgttgcagtctttt
atggtgattaccggcgggccaggaacgggcaaaacgacaacggttgccaaactgctggcg
ctgatttgcggtgaagacgaaaatcttcccaacatcgcgcttgccgcaccgacaggcaaa
gcggcggcacatatggcgcgcgcgctgcaccgtgcaatcaacggttttgacgcgccggag
gccatccgccgccatttgctcaaactggaagggcaaaccgtccaccgactgctgaagctg
cgcccgcccaaaatgcaggcggcgttcaaccctgtttacccgctgccgtttgacgtattg
gttatcgatgaagcctctatgctggatacggcattgatgctgcaacttttaaaagcggtc
aaaaccggcgcgcgcgtgattctgctgggggatgaaaaccagctcccgtccgtcggaata
ggggcggtgctgtccgttttgtcacaaaaaaccgttttggacggagaaacgcaccaaagg
ctggccggcttccttccggaacacggtttcagcgtcagcgcaaatccacccgtgttggcg
caaaacaccgcccatctgtcgttcagccaccgcttcggcgacaacagcggcatcggctgc
cttgcccgtgccgccgtatcgggcgatgaaggggcgtgggcattgtttgaccggtttccg
gacgaactggaacattcggaatgcagtccgaacgctcgagtcgaaaggttgtaccgggcg
cacaaagcctattggcaggcggtaaaagacggcaatatcgaagccgcatacgcaggcatc
tcggatatcgtcgtcctcgcggcgtggcggcaggatgcggaagacttcaacgaagcctat
tgccgccatgtacgccgcaaaatgaacataccggaacatcaggcctatttcgccggagaa
ccgattatgatcagacagaacgactacgcgcttgaactgttcaacggcgacatcggattg
attatggaagatgtcggacggcagggcggccttgccgcctattttgccgatgcggacgga
tttaaaaaggtagcggtaagctgcctgcccgatttcgaacccgcattcgccatgaccgtc
cacaaaagccaaggttcggaatatcgggaagtctggctgctgccgccttccgccgcacct
tcggacgaaggggacgacgcgctttcgggcttgagcagagggctgctttacacagccatt
acccgcgcgagagagaagttcgtattcttcggcggggaagaagccttccggcaagctgcc
gtcaccgtcaaaacgcgtcagacggcgttgggcagtatgctcgagcgggtattttcacaa
gaataa

DBGET integrated database retrieval system