KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_1323Help
Entry
NMBB_1323         CDS       T01932                                 

Definition
putative recombination protein
Orthology
K06187  
recombination protein RecR
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NMBB_1323
DNA repair and recombination proteins [BR:nmp03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      NMBB_1323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1160744..1161364)
Genome map
AA seq 206 aa AA seqDB search
MMSHKKQDAFQGLIDALKVLPNVGPKSAQRIAYHLLQHKRKEAEKLVDALQTALKQVHHC
AMCNTFCEGGLCDICADETRDGRRLMVVHMPADVSNMEVANCHDGLYFVLMGQINTALGM
DVSAIALDRLAQRLGGGEVEEIIIATAFTAEGNATAYVLSEFFKNLPYKVSRLSQGIPLG
GELEYVDAGTLAQAVYERRLIKEGGA
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgatgagccacaaaaaacaagatgccttccaaggattgatcgacgcgctgaaggtttta
cccaacgtcgggccgaaatcggcacagcggatagcgtatcatttgctccaacacaagcgc
aaagaggctgaaaaactggtggatgccttgcagacggcattgaagcaggttcaccattgc
gcgatgtgcaacacgttttgcgaaggcggattgtgcgatatttgtgccgatgaaacacgc
gacgggcggcggctgatggtggtgcatatgcctgccgacgtgtcgaatatggaagtggca
aactgccacgacgggctgtatttcgtcctgatggggcaaatcaatacggcattgggaatg
gacgtatccgccatcgcattggacaggctggcgcaacggctgggcggcggggaagtcgaa
gaaatcattattgcaaccgcttttaccgcagaaggcaatgcgacggcgtatgtcctgtcc
gagttttttaaaaacctgccttacaaagtcagcaggctgtcgcagggcatccccttgggc
ggcgaattggaatatgtcgatgcgggaacgctggcgcaggcggtgtacgaacgccgcctg
attaaagaaggcggggcataa

DBGET integrated database retrieval system