KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_1355Help
Entry
NMBB_1355         CDS       T01932                                 

Definition
putative threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NMBB_1355
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NMBB_1355
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    NMBB_1355
Enzymes [BR:nmp01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     NMBB_1355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1188287..1189753
Genome map
AA seq 488 aa AA seqDB search
MRQMPSEAVFLQFRQTRKIMKYISTRGETAHKPFSEVLLMGLAPDGGLMLPEHYPQIGRE
ALDKWRGLAYPELAFEIMRLFVTDIPEDDLRDILNRTYTEAAFGTKEITPVRTLSDGIKI
QALSNGPTLAFKDMAMQFLGNAFEYVLNKEGKKLNILGATSGDTGSAAEYALRGKKGVNV
FMLSPDGKMSAFQRAQMYSLQDGNIHNIAVKGMFDDCQDIVKAVQNDAAFKEKYHIGTVN
SINWGRIVAQVVYYFAGYFKATQSNDEQVSFCVPSGNFGNVCAGHIAKQMGLPIRRLIVA
TNENDVLDEFFKTGAYRPRNSAHTYVTSSPSMDISKASNFERFVFDLMDRDPQEINTLWA
EVAAGKGFDLRFALEKVGGKYGFTSGKSTHPDRLATIRQVYEQDQELIDPHTADGVKVAR
EVREEGETVVCLETALAAKFDATIREAVGDAAIPRPAALEGLETLPQRVQTVPNSADAVK
GIIEQTLA
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgaggcagatgccgtctgaagccgttttcctgcaatttcgacagacgagaaaaatcatg
aaatacatcagcacgcgcggcgaaaccgcacacaaaccgttcagcgaagttttattgatg
gggcttgcacccgacggcggcctgatgctgccggaacattatccgcaaatcgggcgggaa
gccttggacaaatggcgcggtttggcttatcccgaattggcgtttgaaatcatgcgcttg
ttcgttacggatattccggaggacgatttgcgcgatattctgaaccgtacttacacggaa
gcggcgttcggtactaaggaaatcacccccgtccgcacgctttcagacggcatcaaaatc
caagccttgtccaacggcccgacgctggcgttcaaagatatggcgatgcagtttttgggc
aatgcgtttgaatatgttttaaacaaagaaggtaaaaaactcaatatcttgggcgcgacc
agcggcgatacgggttcggctgcggaatatgccttgcgcggcaaaaaaggcgtgaacgta
tttatgttgtcacccgacggtaagatgagcgcgttccaacgcgcgcaaatgtacagcctg
caagacggaaatatccacaatatcgccgtgaaggggatgtttgacgattgtcaggacatt
gtgaaggcagtgcaaaacgatgccgcgttcaaggaaaaataccatatcggtacagtcaac
tcgattaactggggacgcatcgtcgcgcaagtggtttattactttgcgggctatttcaag
gcgacgcaaagcaatgacgagcaggtcagcttctgcgtgccgagcggcaacttcggcaac
gtttgcgcgggacacatcgccaaacagatgggtttgcctatccgccgcctgattgtcgcg
accaatgaaaacgatgtgttggacgagtttttcaaaaccggtgcataccgcccgcgcaac
agcgcgcatacttatgttacctccagcccgtcgatggacatttccaaagcgtccaacttc
gagcgtttcgtgttcgacctgatggatcgcgatcctcaggaaatcaatacgctgtgggcg
gaagtagcggcgggcaaaggctttgacctgcggtttgctttagaaaaagtcggtggcaaa
tacggttttacctccggcaaatccacccaccccgaccgcctcgccaccatcagacaggtt
tatgagcaagaccaagaactcatcgacccgcacactgccgacggcgtaaaagtcgcccgc
gaagtgcgcgaagaaggggaaacggttgtgtgtttggaaaccgcgttggcagcgaaattc
gatgcgaccatacgcgaagccgtcggcgatgccgccattccgcgccccgccgcgctggaa
ggtttggaaacattgccgcagcgcgtgcaaaccgtgccgaacagtgcggatgcggtaaaa
ggcatcatcgaacaaacccttgcctga

  All links  
No link information was found.   
DBGET integrated database retrieval system