KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_1546Help
Entry
NMBB_1546         CDS       T01932                                 

Definition
phosphogluconate dehydratase (EC:4.2.1.12)
Orthology
K01690  
phosphogluconate dehydratase [EC:4.2.1.12]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Pentose phosphate pathway
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Class
Metabolism; Overview; Carbon metabolism [PATH:nmp01200]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:nmp00030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1368112..1369947
Genome map
AA seq 611 aa AA seqDB search
MNTTPIHSKLAEITGRIIERSRPTREKYLAKIRSAKQMGRLERNQLGCSNLAHGYAAMPK
SIKIEMLQETVPNLGIITAYNDMVSAHQPFKDFPDQIKDEAQKNGATAQVAGGTPAMCDG
ITQGYAGMELSLFSRDVIAMSTAVGLSHQMFDGSLFMGVCDKIVPGLMIGALSFGHIPGI
FVPAGPMSSGIGNKEKARTRQLFAEGKVGRNELLKSEMGSYHSPGTCTFYGTANSNQMMM
EMMGVHLPAAAFVHPYTDLREALTRYAAGHLARGIKNGTIKPLGEMLTEKSFINALIGLM
ATGGSTNHTMHLVAMARAAGVILNWDDFDEISSIIPLLIRVYPNGKADVNHFTAAGGLPF
VIRELLNAGLLHDDVDTVVGHGMRHYTKEPFLIDGKLEWREAPETSGNDDILRKADNPFS
PDGGLRLMKGNIGRGVIKVSAVREGCRIIEAPAIVFNDQREVLAAFERGELERDFVCVVR
YQGPRANGMPELHKLTPPLGILQDRGFKVALLTDGRMSGASGKVPASIHMTPEALMGGNI
AKIRTGDLIRFDSVSGELNVLINETEWNAREVESIDLGANQQGCGRELFANFRSMTSSAE
TGAMSFGGEFA
NT seq 1836 nt NT seq  +upstreamnt  +downstreamnt
gtgaacactactcctatccactccaaactcgccgaaatcaccgggcgcattattgaacgc
agccgtccgacgcgtgaaaaatatctggcgaagatccgcagtgccaaacaaatgggacgc
ttagagcgcaaccagctcggctgcagcaacttggcacacggctatgctgccatgcctaaa
agtatcaaaatcgaaatgcttcaggaaaccgtccccaacttaggcatcatcaccgcctac
aacgacatggtttccgcacaccagccgtttaaagacttccctgaccaaatcaaagacgaa
gcgcagaaaaacggcgcgaccgcccaagtcgccggcggcacgcccgccatgtgcgacggc
atcacgcaaggctacgccggcatggaactgtcgctgttctcccgcgacgtgattgccatg
agtaccgccgtcgggctgtcgcatcaaatgtttgacggcagcctgtttatgggcgtatgc
gacaaaatcgttccgggtttgatgataggcgcgctttcgttcggtcatattccgggtatc
ttcgtccccgcaggcccgatgtccagcggtatcggcaacaaagaaaaagcccgcacccgc
cagcttttcgccgaaggcaaggtcggacgcaacgaacttttgaaaagcgaaatgggttct
taccacagcccgggcacctgcactttctacggcacggcaaactccaaccaaatgatgatg
gaaatgatgggcgtgcacctgcctgccgccgccttcgtccacccttacaccgacctgcgc
gaagcgctgactcgctacgccgccggacacctcgcgcgcggcatcaaaaacggcacgatt
aaacctttgggcgaaatgttgaccgaaaaatcctttatcaacgccttgattggcctgatg
gcaaccggcggttcgaccaaccacaccatgcacctcgtcgctatggcgcgtgcggccggc
gtgattttgaactgggacgacttcgacgaaatttcctccatcatcccactactcatccgc
gtttatccgaacggcaaggccgacgtgaatcactttaccgcagcgggcggactgcctttc
gttatccgcgaattgctgaatgcaggcctgttgcacgacgatgtcgataccgtcgtcgga
cacggtatgcgccactacaccaaagagcctttcctcatcgacggcaaactcgaatggcgc
gaagcccccgaaaccagcggcaacgacgacatcctgcgtaaagctgacaacccgttctcc
cccgacggcggtctgcgcctgatgaaaggcaacatcggacgtggcgtgattaaagtgtcc
gccgtgcgcgaaggctgccgcattattgaagcgcctgccatcgtgttcaacgaccaacgc
gaagtgttggctgcgtttgaacgcggcgagttggaacgcgattttgtgtgcgtcgtccgc
taccaaggcccgcgtgccaacggtatgcccgaattgcacaaactgaccccgcctttgggc
atcctgcaagaccgcggcttcaaagtggcactgctgaccgacggtcgtatgtccggcgca
tccggcaaagttccggcctccatccacatgacgcccgaagccctgatgggcggcaacatc
gccaaaatccgtaccggcgacctgatccgcttcgactccgttagcggcgaactcaacgtc
ctgattaacgaaaccgaatggaatgcccgcgaagtcgaaagcatcgacttgggcgcgaac
caacaaggctgcggccgcgaacttttcgccaacttccgcagcatgaccagcagcgccgaa
accggcgcgatgagcttcggcggcgaatttgcctga

DBGET integrated database retrieval system