KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_1674Help
Entry
NMBB_1674         CDS       T01932                                 

Definition
putative dihydrolipoamide succinyltransferase E2 component (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NMBB_1674
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBB_1674
  Amino acid metabolism
   00310 Lysine degradation
    NMBB_1674
Enzymes [BR:nmp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     NMBB_1674
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1488661..1489854)
Genome map
AA seq 397 aa AA seqDB search
MIIDVKVPMLSESVSEGTLLEWKKKVGEAVARDEILIDIETDKVVLEVPSPQAGVLVEIV
AQDGETVVADQVLARIDTAATAAAEAPVAAPAEAAPAAAPAAAPAAAQNNAAMPAAAKLA
AETGVDVNALQGSGRDGRVLKEDVQNAAAKPAAAAAPAVALPAGARPEERVPMSRLRARV
AERLLASQQENAILTTFNEVNMKPIMDLRAKYKEKFEKEHGVKLGFMSFFVKAAVAALKK
YPVVNASVDGKDIVYHGYFDIGIAIGSPRGLVVPILRDADQMSIADIEQAIVDYAKKAKD
GKIAIEDLTGGTFSITNGGTFGSMMSTPIINPPQSAILGMHATKERAVVENGQVVVRPMM
YLALSYDHRIIDGREAVLTLVAIKDALEDPARLLLDL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgattattgatgtaaaagtacctatgctgtctgaaagcgtatctgaaggcacgctcttg
gaatggaagaaaaaagttggcgaagcagttgcccgtgacgaaatcctgatcgatatcgaa
acggacaaagtggttttggaagtcccttccccacaagccggcgtattggttgaaatcgta
gcgcaagacggtgaaaccgttgttgccgaccaagttttggcacgcatcgatacagctgct
actgccgctgccgaagcacccgtagccgctcctgccgaagccgccccggctgccgctcct
gctgccgctcctgctgccgcacaaaacaacgccgctatgcctgccgccgccaaactggct
gcggagaccggtgttgacgtgaacgcattgcaaggttccggccgcgacggtcgcgtattg
aaagaagacgtacaaaatgccgctgccaaacctgccgcagccgctgctcctgctgttgca
cttcctgccggcgcacgtcctgaagaacgcgtaccaatgagccgcctgcgtgcccgtgtt
gcagaacgcctcttggcttctcaacaagaaaacgccattctgactacattcaacgaagtc
aacatgaaacctatcatggacttgcgtgcgaagtacaaagaaaaatttgagaaagaacac
ggcgtgaaattgggctttatgtccttcttcgttaaagccgctgttgccgccctgaaaaaa
tacccggttgtgaatgcttctgttgacggcaaagacatcgtttaccacggctacttcgac
atcggtatcgcgattggcagcccacgcggtttggttgtgccaatcctgcgcgatgccgac
caaatgagcattgcagacatcgaacaagcaattgttgattacgcgaaaaaagccaaagac
ggcaaaatcgctatcgaagatctgaccggcggtacattcagtattaccaacggcggtact
ttcggttctatgatgtctaccccgatcatcaacccgcctcaatctgcaattttgggtatg
cacgccactaaagagcgcgctgtggttgaaaacggtcaagttgttgtccgtccaatgatg
tatctggctctgtcttacgaccaccgtatcattgacggccgcgaagctgtattgaccttg
gtagccattaaagacgcgttggaagacccagcccgcctgttgttggatctgtaa

DBGET integrated database retrieval system