KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_1680Help
Entry
NMBB_1680         CDS       T01932                                 

Definition
(GenBank) putative succinate dehydrogenase hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
nmp00020  Citrate cycle (TCA cycle)
nmp00190  Oxidative phosphorylation
nmp00650  Butanoate metabolism
nmp01100  Metabolic pathways
nmp01110  Biosynthesis of secondary metabolites
nmp01120  Microbial metabolism in diverse environments
nmp01130  Biosynthesis of antibiotics
nmp01200  Carbon metabolism
Module
nmp_M00009  Citrate cycle (TCA cycle, Krebs cycle)
nmp_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
nmp_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NMBB_1680
   00650 Butanoate metabolism
    NMBB_1680
  Energy metabolism
   00190 Oxidative phosphorylation
    NMBB_1680
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt Fumarate_red_C CybS
Motif
Other DBs
NCBI-ProteinID: ADO31932
UniProt: E3D6G2
Position
complement(1497227..1497568)
Genome map
AA seq 113 aa AA seqDB search
MVERKLTGAHYGLRDWVMQRATAVIMLIYTVALLVVLFSLPKEYSAWQAFFSQTWVKVFT
QVSFIAVFLHAWVGIRDLWMDYIKPFGVRLFLQVATIVWLVGCLVYSVKVIWG
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggtagaacgtaaattgaccggtgcccattacggtttgcgcgattgggtgatgcaacgt
gcgactgcggttattatgttgatttataccgttgcacttttagtggttctattttccctg
cctaaagaatattcggcatggcaggcattttttagtcaaacttgggtaaaagtatttacc
caagtgagcttcatcgccgtattcttgcacgcttgggtgggtatccgcgatttgtggatg
gactatatcaaacccttcggcgtgcgtttgtttttgcaggttgccaccatcgtttggctg
gtcggctgtctcgtgtattcagttaaagtgatttgggggtaa

DBGET integrated database retrieval system