KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_1906Help
Entry
NMBB_1906         CDS       T01932                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
nmp00230  Purine metabolism
nmp01100  Metabolic pathways
Module
nmp_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NMBB_1906
Enzymes [BR:nmp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     NMBB_1906
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_16 AAA_33 cobW AAA_22 MobB AAA_25 AAA_18 CbiA NTPase_1 AAA_28 MMR_HSR1 RsgA_GTPase Thymidylate_kin
Motif
Other DBs
NCBI-ProteinID: ADO32103
UniProt: E3D1S7
Position
complement(1698936..1699553)
Genome map
AA seq 205 aa AA seqDB search
MSAYRKGNIFIISAASGTGKTTLVSRLLANHNGLRVSVSHTTRPPREGEANGVHYHFVSK
EEFESLIAQEAFLEYADVFGNYYGTSAEGVNALAAAGYDVILEIDVQGAAQVRDALPEAV
GIFILPPSFDVLAARLNGRGTDSQEVIQRRLAKARHEIEQSVLFDFVVVNDDLARAEEDL
RHIVNACRLKRSRQLGFIADLLENS
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtccgcttatcgaaaaggcaacatctttatcatttcggccgcttccggcacgggcaaa
accacgctggtgtcgcggctgttggcaaaccataacggtttgcgcgtttccgtgtcgcac
acgacgcgcccgccgcgtgaaggcgaagcaaacggcgtacattatcactttgtttccaaa
gaagagtttgagtcgcttatcgcacaggaggcttttttggaatacgcagacgtattcggc
aactattacggcacaagcgcggagggcgtgaatgcgttggcggcggcaggttatgacgtg
attttggaaatcgacgttcagggcgcggcgcaggttcgagatgcgctgcctgaagctgtc
ggcatctttatcctgccgccgtctttcgatgtgcttgccgcgcgtctcaacggacgcggg
acggacagtcaggaagttatccaaaggaggcttgcgaaggcaaggcatgaaatcgaacag
tccgtattgttcgactttgtcgtggtcaatgacgacttggcgcgggcggaggaggatttg
cgccatattgtgaatgcctgccgtctgaaaaggtcgcggcaactgggatttattgcagat
ttgttggaaaattcctaa

DBGET integrated database retrieval system