KEGG   Neisseria meningitidis alpha710 (serogroup B): NMBB_391Help
Entry
NMBB_391          CDS       T01932                                 

Definition
putative phospholipase
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
nmp  Neisseria meningitidis alpha710 (serogroup B)
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:nmp00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NMBB_391
   00565 Ether lipid metabolism
    NMBB_391
   00590 Arachidonic acid metabolism
    NMBB_391
   00591 Linoleic acid metabolism
    NMBB_391
   00592 alpha-Linolenic acid metabolism
    NMBB_391
Enzymes [BR:nmp01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     NMBB_391
    3.1.1.32  phospholipase A1
     NMBB_391
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
485928..487055
Genome map
AA seq 375 aa AA seqDB search
MNTRNMRYILLTGLLPMASAFGETALQCAALTDNVTRLVCYDRIFAAQLPSSAGQEGQES
KAVLNLTETVRSSLDKGEAVIVVEKGGDALPADSAGETADIYTPLSLMYDLDKNDLRGLL
GVREHNPMYLMPLWYNNSPNYAPSSPTRGTTVQEKFGQQKRAETKLQVSFKSKIAEDLFK
TRADLWFGYTQRSDWQIYNQGRKSAPFRNTDYKPEIFLTQPVKADLPFGGRLRMLGAGFV
HQSNGQSRPESRSWNRIYAMAGMEWGKLTVIPRVWVRAFDQSGDKNDNPDIADYMGYGDV
KLQYRLNDRQNVYSVLRYNPKTGYGAIEAAYTFPIKGKLKGVVRGFHGYGESLIDYNHKQ
NGIGIGLMFNDLDGI
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacggaatatgcgctatattcttttgacaggactgttgccgatggcatccgct
tttggagagaccgcgctgcaatgcgccgctttgacggacaatgttacgcgtttggtgtgt
tacgacaggatttttgcggcacagcttccgtcttcggcagggcaggaagggcaggagtcg
aaagccgtactcaatctgacggaaaccgtccgcagcagcctggataagggcgaggcggtc
attgttgttgaaaaaggcggggatgcgcttcctgccgacagtgcgggcgaaaccgccgac
atctatacgcctttgagcctgatgtacgacttggacaaaaacgatttgcgcgggctgttg
ggcgtacgcgaacacaatccgatgtaccttatgccgctctggtacaataattcgcccaac
tatgccccgagttcgccgacgcgcggtacgactgtacaggaaaaattcggacagcagaaa
cgtgcggaaaccaaattgcaggtttcgttcaaaagcaaaattgccgaagatttgtttaaa
acccgcgcggatctgtggttcggctacacccaaagatccgattggcagatttacaaccaa
ggcaggaaatccgcgccgttccgcaatacggattacaaacctgaaattttcctgacccag
cctgtgaaggcggatttgccgttcggcggcaggctgcgtatgctcggtgcgggttttgtc
caccagtccaacggacagagccgtcccgaatcgcgttcgtggaacaggatttacgccatg
gcaggcatggaatggggcaaattgacggtgattccgcgcgtgtgggtgcgtgcgttcgat
cagagcggcgataaaaacgacaatcccgatattgccgactatatggggtatggcgacgtg
aagctgcagtaccgcctgaacgacaggcagaatgtgtattccgtattgcgctacaacccc
aaaacgggctacggcgcgattgaagccgcctacacgtttccgattaagggcaaactcaaa
ggcgtggtacgcggattccacggttacggcgagagcctgatcgactacaaccacaagcag
aacggtatcggtatcgggttgatgttcaacgacttggacggcatctga

DBGET integrated database retrieval system