KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_0090Help
Entry
NMBM04240196_0090 CDS       T01948                                 

Gene name
rfbC2
Definition
dTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of terpenoids and polyketides; Polyketide sugar unit biosynthesis [PATH:nmq00523]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:nmq00521]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
96795..97334
Genome map
AA seq 179 aa AA seqDB search
MNIIDTAIPDVKLLEPQVFGDARGFFMETFRDEWFKTQVCERTFVQENHSKSGKGVLRGL
HYQTENTQGKLVRVVVGEVFDVAVDMREGSPTFGKWAGATLSAQNQCQLWIPEGFAHGFY
VLSDTAELTYKCTDYYKPEAEQVLIWNDPAIGIDWPLQGEPNLSPKDLAGKVLAEAVTF
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atgaacatcattgataccgccattcctgacgtaaaactgcttgagccccaagtcttcggc
gacgcgcgcggcttttttatggaaaccttccgcgacgagtggtttaaaacccaagtctgc
gaacgcaccttcgtgcaggaaaaccactccaaatccggcaaaggcgtattgcgcggcctg
cactaccaaaccgaaaacacacaaggcaaactcgtacgcgtagttgtcggcgaagtgttc
gacgtggccgtcgatatgcgcgaaggttcgccgactttcggcaaatgggcgggtgcaacc
ctgtccgcgcaaaaccaatgccagctttggatacccgaaggcttcgcacacggtttttac
gttttgagcgacacggccgaacttacctacaaatgcacagactattacaagccagaagcc
gaacaggttttaatatggaacgacccggcaataggcatagactggccgctacaaggcgag
ccgaacctgtcgcctaaagacttggccggcaaagtattggctgaagcggtcacgttttaa

DBGET integrated database retrieval system