KEGG   Neisseria meningitidis M04-240196 (serogroup B): NMBM04240196_0397Help
Entry
NMBM04240196_0397 CDS       T01948                                 

Gene name
galM
Definition
aldose 1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
nmq  Neisseria meningitidis M04-240196 (serogroup B)
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:nmq00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NMBM04240196_0397 (galM)
   00052 Galactose metabolism
    NMBM04240196_0397 (galM)
Enzymes [BR:nmq01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     NMBM04240196_0397 (galM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
400943..401953
Genome map
AA seq 336 aa AA seqDB search
MSDTPATRDFGLIDGRAVTGYVLSNRRGTRVCVLDLGGIVQEFSVLADGVRENLVVSFDD
AASYADNPFQINKQIGRVAGRIRGAAFDINGRTYRVEANEGRNALHGGSHGLAVTRFNAV
AADGRSVVLRSRLQQSADGYPNDLDLDISYRLDEDDRLTVSYRATALGDTVFDPTLHIYW
RLDAGLHDAVLHIPQGGHIPADAEKLPVSTVSDGLEVFDFSRPKPLDAAVAALRRETGRA
GFDDAYRVPSDIGRPAAVLQAGRRRRISIYSDRNGLVIFTAAPQDFARHDAGVYDALATE
AQTLPDSLHWPEFGNIRLNKGDTREATIAYGIESLS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgagcgatacccccgctacccgcgattttggcctgatcgacgggcgtgccgtaaccggc
tatgtgctgtccaaccggcgtggtacgcgtgtctgcgtgctggacttgggcgggattgtg
caggaattttccgttttggcagacggcgtgcgcgaaaacctcgtggtgtcgttcgacgat
gcggcttcctatgcggacaatccgtttcagattaacaagcagatagggcgcgtggccgga
cgcatccgcggtgcggcgttcgacatcaacggcaggacttaccgcgtggaggccaacgaa
ggcaggaacgcgctgcacggcggttcgcacgggctggccgttacccgtttcaacgcggtg
gcggcagacggccgttcggtggtgctgcgcagccgcctgcaacagtcggccgacggttat
cccaacgatttggatttggatatttcctaccgcttggacgaggacgaccggcttaccgtt
agctatcgcgccaccgcgctcggcgacacggtgttcgacccgacgctgcacatttactgg
cggctggacgcgggcctgcacgatgcggttctgcatattccgcagggcggacatattccg
gccgatgccgaaaaactgcccgtctcaacggtttcagacggcctcgaagtatttgatttc
agccggcccaagccgctggatgccgccgttgccgccctgcgccgcgaaacgggccgggcc
ggttttgacgacgcttaccgcgtgccgtccgatataggccgtcccgccgctgtgttgcaa
gccggacgccgccgtcgtatcagcatatacagcgaccgcaacggcttggtcatctttacc
gccgccccgcaggatttcgcgcggcacgatgcgggcgtttacgacgcgctggcgaccgag
gcgcagacgctgcccgacagcctgcattggcccgagttcggcaatattcgtctgaacaag
ggtgataccagggaggcgacgattgcttacggcatcgaatccctttcttag

DBGET integrated database retrieval system